KEGG   Podarcis muralis (common wall lizard): 114596831
Entry
114596831         CDS       T06059                                 

Gene name
FADD
Definition
(RefSeq) FAS-associated death domain protein isoform X1
  KO
K02373  FAS-associated death domain protein
Organism
pmua  Podarcis muralis (common wall lizard)
Pathway
pmua04210  Apoptosis
pmua04217  Necroptosis
pmua04620  Toll-like receptor signaling pathway
pmua04621  NOD-like receptor signaling pathway
pmua04622  RIG-I-like receptor signaling pathway
pmua05132  Salmonella infection
pmua05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pmua00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    114596831 (FADD)
   04217 Necroptosis
    114596831 (FADD)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    114596831 (FADD)
   04621 NOD-like receptor signaling pathway
    114596831 (FADD)
   04622 RIG-I-like receptor signaling pathway
    114596831 (FADD)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    114596831 (FADD)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    114596831 (FADD)
SSDB
Motif
Pfam: Death DED Mor
Other DBs
NCBI-GeneID: 114596831
NCBI-ProteinID: XP_028584404
LinkDB
Position
1
AA seq 212 aa
MTPEPPDRQQSSNQEVSSPEMDPFLDLLNLFSRSLSPKELADLKFLCRDRIGKKKLEAVQ
SGLDLFNIFLEQEIVTRTKVEFLEHAFKSLQREDLLTLLRQFEDGASGGPEDQLDAQEKR
KLDRAFEIICDHVGKNWKMLVRKLGISEVKIDRIVTANPYNMHEQMMQSLLEWRKSRGKE
AKVDDVIKALKNCHMKLAADYVEEALQRETEQ
NT seq 639 nt   +upstreamnt  +downstreamnt
atgacgccggagcctccggatcgacaacaaagttccaaccaggaagtaagttccccagaa
atggatccgtttttggatcttctgaatttattctcgaggagcctttctccaaaggagctc
gctgatctcaagttcctttgccgggatcgcattggcaaaaaaaagctcgaggccgtgcag
agtggcctcgatctattcaacattttcctggaacaggaaatagttacgaggaccaaggtg
gagttcttggagcacgccttcaaaagcctgcaaagagaagatctgctgactttgctcagg
cagtttgaagacggcgcaagtgggggcccggaagatcagctggatgcgcaagaaaaacgt
aagctggacagagcatttgagatcatatgtgatcacgttgggaaaaactggaaaatgctc
gttcgaaaacttggcatctcagaagtcaaaatcgatagaattgtaactgccaatccatat
aacatgcatgaacaaatgatgcaatcgcttctagagtggcggaaatcaagggggaaggaa
gcaaaggttgacgatgtaatcaaagccctcaagaactgtcatatgaaacttgcggcagac
tatgttgaagaagctttgcaacgggaaactgaacaatga

DBGET integrated database retrieval system