KEGG   Podarcis muralis (common wall lizard): 114596879
Entry
114596879         CDS       T06059                                 

Gene name
CCND1
Definition
(RefSeq) G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
pmua  Podarcis muralis (common wall lizard)
Pathway
pmua04068  FoxO signaling pathway
pmua04110  Cell cycle
pmua04115  p53 signaling pathway
pmua04218  Cellular senescence
pmua04310  Wnt signaling pathway
pmua04340  Hedgehog signaling pathway
pmua04371  Apelin signaling pathway
pmua04510  Focal adhesion
pmua04530  Tight junction
Brite
KEGG Orthology (KO) [BR:pmua00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    114596879 (CCND1)
   04340 Hedgehog signaling pathway
    114596879 (CCND1)
   04371 Apelin signaling pathway
    114596879 (CCND1)
   04068 FoxO signaling pathway
    114596879 (CCND1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    114596879 (CCND1)
   04115 p53 signaling pathway
    114596879 (CCND1)
   04218 Cellular senescence
    114596879 (CCND1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    114596879 (CCND1)
   04530 Tight junction
    114596879 (CCND1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 114596879
NCBI-ProteinID: XP_028584544
LinkDB
Position
1
AA seq 292 aa
MEHQLLCCEVETIRRAYQDTNLLNDRVLQTMLKAEETCSPSVSYFKCVQKEILPYMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRYLSFEPLKKTRLQLLGATCMFVASKMKETIPLT
AEKLCIYTDNSIRPNELLQMELLLVNKLKWNLAAMTPHDFIEHFLSKMPVAEDSKQIIRK
HAQTFVALCATDVKFISNPPSMIAAGSVVAAVQGLHLGNTNAFLSYQCLTHFLSKVIKCD
PDCLRACQEQIESLLESSLRQAQQHNISSETKTVEDEADLSCTPTDVRDVNI
NT seq 879 nt   +upstreamnt  +downstreamnt
atggaacatcagctgctctgctgtgaagtggagaccatcaggagagcctaccaagacacc
aacctgctcaatgacagggtcttgcagacgatgctgaaagcagaggagacctgctcgccc
tcggtctcctacttcaagtgcgtgcagaaggagatcttaccatatatgaggaaaatagtg
gccacttggatgttggaggtttgtgaggagcagaaatgtgaagaggaggttttccccttg
gctatgaactatttggaccgatatctctccttcgaacccctcaagaaaacccgcctgcaa
ctgctgggagctacctgcatgtttgtggcttcgaaaatgaaggaaaccattcctctaact
gcagaaaaactgtgtatttacactgataactccattagacccaacgaattactgcaaatg
gaactgcttctggtgaataagctgaaatggaatctggctgccatgacccctcatgacttt
attgaacattttctaagtaaaatgcctgtggctgaggacagcaagcagatcatccgtaaa
cacgcccagacttttgtggctctatgtgctacagatgttaagtttatttcaaatccacct
tccatgattgcagctggtagtgtggtagctgctgtgcaaggccttcaccttggaaacacc
aacgctttcctctcttaccaatgcctcacacatttcctctcgaaagtcatcaaatgtgac
ccggattgtttacgagcctgccaagaacagattgaatccctccttgaatctagtctacgc
caggcgcagcaacacaacatatcttcagaaacaaagactgttgaagatgaagctgatctt
tcctgcacacccactgatgttagagatgtgaatatttaa

DBGET integrated database retrieval system