KEGG   Podarcis muralis (common wall lizard): 114597036Help
Entry
114597036         CDS       T06059                                 

Gene name
CAMK2G
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type II subunit gamma isoform X1
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
pmua  Podarcis muralis (common wall lizard)
Pathway
pmua04012  ErbB signaling pathway
pmua04020  Calcium signaling pathway
pmua04114  Oocyte meiosis
pmua04217  Necroptosis
pmua04261  Adrenergic signaling in cardiomyocytes
pmua04310  Wnt signaling pathway
pmua04912  GnRH signaling pathway
pmua04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:pmua00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    114597036 (CAMK2G)
   04310 Wnt signaling pathway
    114597036 (CAMK2G)
   04020 Calcium signaling pathway
    114597036 (CAMK2G)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    114597036 (CAMK2G)
   04217 Necroptosis
    114597036 (CAMK2G)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    114597036 (CAMK2G)
   04916 Melanogenesis
    114597036 (CAMK2G)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    114597036 (CAMK2G)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pmua01001]
    114597036 (CAMK2G)
Enzymes [BR:pmua01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     114597036 (CAMK2G)
Protein kinases [BR:pmua01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   114597036 (CAMK2G)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase CaMKII_AD Pkinase_Tyr SnoaL_3 DUF4440 Kdo SnoaL_2 RIO1
Motif
Other DBs
NCBI-GeneID: 114597036
NCBI-ProteinID: XP_028584883
LinkDB All DBs
Position
5
AA seq 632 aa AA seqDB search
MASPATCTRFTDEYQLYEELGKGAFSVVRRCVKKTSSQEYAAKIINTKKLSARDHQKLER
EARICRLLKHPNIVRLHESISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIHQI
LESVNHIHQHDIVHRDLKPENLLLASKCKGAAVKLADFGLAIEVQGEQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDT
VTPEAKNLINQMLTINPAKRITADQALKHPWVCQRSTVASMMHRQETVECLRKFNARRKL
KGAILTTMLVSRNFSVGRQSSAPASAAMSAAGLAEQAAKSLLNKKSDGVKKRKSSSSVHL
MPQTNNKASVVSPAKESAPVQMSMEPQTTVVHNANDGIKGSTESCNTTTEDEDLKAPPLS
IGDGSSVLEGRSHCESKTQTESMQSQLSLCYSATTTTQSCEEKLLAWDSPGQTVELDRAQ
SEPVLTPVVPFALNNPPLRKQEIIKITEQLIEAINNGDFEAYTKICDPGLTSFEPEALGN
LVEGMDFHKFYFENLLSKNNSKPIHTTILNPHVHVIGDDAACIAYIRLTQYIDGQGRPRT
TQSEETRVWHRRDGKWLNVHYHCSGAPAAPLQ
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atggcctccccggcaacgtgcacccgcttcaccgatgaataccagctgtacgaggagctc
ggcaagggagctttttcagtggtccggagatgtgtgaaaaaaacatcatcccaggagtac
gctgcgaagataatcaataccaagaagctgtcggccagagatcaccagaaactggaacgt
gaggctcgaatctgccgattattaaaacacccaaatatcgtgcggctccatgagagcatt
tcggaagaaggcttccactacctcgtctttgatctggtcactggtggagagctttttgaa
gacattgttgctagggaatattacagtgaagcggatgccagccactgcattcaccagatt
ttggagagtgtcaatcatatccatcagcatgatattgtacacagggacttgaagcctgag
aacttgctacttgcgagtaagtgcaagggtgcagctgtcaagctggctgacttcggactt
gcgattgaagttcagggggagcaacaggcatggtttgggtttgctggtactccaggctac
ctgtcccccgaggtcttaagaaaagatccttatggaaaacccgtggatatatgggcatgt
ggtgtcattctgtacatattgctagtggggtaccccccattttgggatgaagatcagcac
aaactgtatcagcagatcaaggcaggagcctacgattttccgtctccagaatgggacact
gtgactccggaagcgaagaacttaatcaaccagatgctgacaataaacccagcaaaacgt
atcacagctgaccaggctcttaagcacccatgggtctgccaacgatcaactgtggcctcc
atgatgcacagacaggagactgtggaatgtttgaggaagttcaatgccagaagaaagctg
aagggtgcaatcctcacaacaatgctggtgtctcggaatttttcagttggcaggcagagc
tccgcccctgcttcggccgccatgagtgctgccggcctggctgagcaagctgccaaaagc
ttactgaacaagaagtctgatggagtaaagaaaaggaagtcaagctccagcgtgcatttg
atgccgcagaccaacaacaaagccagtgtagtaagcccagcaaaagaatcagccccagtg
cagatgtccatggaaccacaaactactgttgtgcacaatgctaatgatggcataaagggt
tccacggagagctgtaatactaccactgaagatgaagacctgaaggcgccccctctctcc
atcggggatggcagctcagtgctcgaaggacggagtcactgtgagagcaaaacccagact
gagtccatgcagtcccagctttctctctgttactcagccactaccactacacaatcttgt
gaagagaaactacttgcctgggacagcccagggcaaactgtggagttggatcgcgctcag
tcggagcctgttctaactcctgtagttccatttgcacttaacaatccgccattgcgtaaa
caagagatcataaagataacggagcagctgattgaggcaatcaacaatggggacttcgag
gcatacacgaagatctgtgaccctggattaacctcatttgaacctgaagcactggggaat
ctcgtggagggaatggatttccacaagttttactttgagaacttattgtccaagaacaac
agcaagccaatccacaccaccatcctgaacccccacgttcacgttattggtgatgacgca
gcctgcattgcttacatccgcttgacacagtatatcgacggtcaaggccgaccccgcacc
acacagtcggaagaaacccgtgtttggcaccgccgtgacggcaagtggctgaatgtccac
taccactgctctggggccccggcagctccactccagtga

DBGET integrated database retrieval system