KEGG   Podarcis muralis (common wall lizard): 114597506
Entry
114597506         CDS       T06059                                 

Gene name
GSTO1
Definition
(RefSeq) glutathione S-transferase omega-1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
pmua  Podarcis muralis (common wall lizard)
Pathway
pmua00480  Glutathione metabolism
pmua00980  Metabolism of xenobiotics by cytochrome P450
pmua00982  Drug metabolism - cytochrome P450
pmua00983  Drug metabolism - other enzymes
pmua01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmua00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    114597506 (GSTO1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    114597506 (GSTO1)
   00982 Drug metabolism - cytochrome P450
    114597506 (GSTO1)
   00983 Drug metabolism - other enzymes
    114597506 (GSTO1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pmua02000]
    114597506 (GSTO1)
Enzymes [BR:pmua01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     114597506 (GSTO1)
Transporters [BR:pmua02000]
 Other transporters
  Pores ion channels [TC:1]
   114597506 (GSTO1)
SSDB
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_3 GST_C GST_C_2 Glutaredoxin GST_C_5
Other DBs
NCBI-GeneID: 114597506
NCBI-ProteinID: XP_028586176
LinkDB
Position
5
AA seq 270 aa
MWAETVGRLRGGSLSSVSITCLLTTPGRMSGEFARSLGKGSSAPGPVPEGVIRLYSMRYC
PFAQRTRLVLKAKGINHEIVNINLKNKPDWFFEKSPFGLVPVLETSKGQLIYESPITCEY
LDEAYPEKKLYPADPYEKAYQKMLLEQFSKLTPLCHKYLLAVRSGDNASAVKNELRERLL
KLEEILVNRKTKYFGGNTVSMIDYLIWPWFERMEPYELYDCLDHTPELKHWVEAMRLDPA
VKATVNDAQTYKGFLELYLKNSHEACDYGL
NT seq 813 nt   +upstreamnt  +downstreamnt
atgtgggcggagacagtcggccgactccggggaggttccctttcttcggtgtccatcact
tgcctgctgactacaccagggagaatgtctggggaattcgctaggagcttaggaaaagga
agttctgctccagggcctgtgccggagggagtgatccgtctttacagtatgcgctactgc
ccttttgcacagagaacaaggctagtcctcaaagccaaaggaatcaatcatgaaattgtc
aatatcaacttgaaaaacaagccagactggttttttgagaaaagcccattcggattggta
cctgtgctagagaccagcaagggccagttgatttatgagtctccaatcacttgtgagtat
ttggatgaagcgtatccagagaagaagctgtatcctgcagatccttatgagaaagcttat
cagaagatgctcttggaacagttctccaagctaactcctctgtgtcacaagtatttgctg
gccgtcaggagtggagacaatgcctctgcagtgaagaatgagctccgagaaaggcttctg
aaacttgaagagattctagtaaaccgcaagactaagtatttcggtggaaacactgtttcc
atgatcgactatctgatctggccttggtttgagcgtatggagccctacgagttatatgac
tgtttggaccacacaccagagctaaaacactgggttgaagccatgaggctggatccggct
gtcaaggctacagtaaacgacgctcagacatacaaaggcttcctggagctctatctgaag
aacagccacgaggcctgcgactacgggctctga

DBGET integrated database retrieval system