KEGG   Podarcis muralis (common wall lizard): 114598597
Entry
114598597         CDS       T06059                                 

Gene name
CACNA1E
Definition
(RefSeq) voltage-dependent R-type calcium channel subunit alpha-1E isoform X1
  KO
K04852  voltage-dependent calcium channel R type alpha-1E
Organism
pmua  Podarcis muralis (common wall lizard)
Pathway
pmua04010  MAPK signaling pathway
pmua04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:pmua00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114598597 (CACNA1E)
   04020 Calcium signaling pathway
    114598597 (CACNA1E)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:pmua04040]
    114598597 (CACNA1E)
Ion channels [BR:pmua04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   114598597 (CACNA1E)
SSDB
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel Lustrin_cystein
Other DBs
NCBI-GeneID: 114598597
NCBI-ProteinID: XP_028588265
LinkDB
Position
6
AA seq 2191 aa
MMFSLGTCSLSAHMLPESGSYPPGGSPELDSDSQRCMLALPEEEAWRKHRLGLMQPAQSC
SLLEPETLTDTLVSRTTSFDGLYELRSQERESSLGLEGGSTLDVGQSQLIPVSPEVIKRR
RGGLIEQRDIIKAHEAHKMQSTPQARRKEWEMARFGEAMAGRLGSGDGAAEQNRNRQGAP
APPGGTPVAYKQTKAQRARTMALYNPIPVRQNCFTVNRSLFIFGEDNIVRKYAKKLIDWP
PFEYMILATIIANCIVLALEQHLPEDDKTPMSRRLEKTEPYFIGIFCFEAGIKIVALGFV
FHKGSYLRNGWNVMDFIVVLSGILATAGTHFNTHVDLRTLRAVRVLRPLKLVSGIPSLQI
VLKSIMKAMVPLLQIGLLLFFAILMFAIIGLEFYSGKLHRACYVNNSGELQELDPPHPCG
VQGCPAGYECREWIGPNDGITQFDNILFAVLTVFQCITMEGWTTVLYNTNDALGATWNWL
YFIPLIIIGSFFVLNLVLGVLSGEFAKERERVENRRAFMKLRRQQQIERELNGYRAWIDK
AEEVMLAEENKNSGTSALEVLRRATIKRNRTEVMNRDSSDERVDISSVGTPLARASIKSA
KLDGASYFRHKERLLRISVRHMVKSQVFYWLVLSIVALNTACVAIVHHSQPPWLTHLLYY
AEFIFLGLFLLEMSLKMYGMGPRLYFHSSFNCFDCGVTVGSIFEVVWTIFRPGTSFGISV
LRALRLLRIFKITKYWASLRNLVVSLMSSMKSIISLLFLLFLFIVVFALLGMQLFGGRFN
FMDGTPSANFDTFPAAIMTVFQILTGEDWNEVMYNGIRSQGGVSSGMWSSIYFIILTLFG
NYTLLNVFLAIAVDNLANAQELTKDEQEEEEAFNQKHALQKAKEVSPMSAPNMPAIERDR
RRRHHMSMWEPRTSNLRERRRRHHMSVWEQRTSQLRRHMQMSSQEGINKDDPSLLNPHAN
AFRRRRLLENSGLEKNEEERTEKSERANEEGTALQIPGSNPCPGSMEDQKSVWHHKSFHG
NCDLNEQEGGASVTFEDRARLRQSQRRSRHRRVRTEAKENRSASQEAGPEAVSPAEGEQN
QEQKKNEEEKEGLIEKEPVVGEELKRTNEAPAKDAEFAAAPQEPSPSEGHLELDKGKDAS
PTEQDGSSLDTSEQALLGDLPMETGRTISRSEPDLSSVTTNMEKATESTTIMIDVQDSAV
VQISNKTDGEASPLKEAETKEEEEAEAEKKKKKQKKKKPVGKPMVPHSSMFIFSTTNPIR
RVCHYIVNLRYFEMCILLVIAASSIALAAEDPVLTNSERNKVLRYFDYVFTGVFTFEMVI
KMIDQGLILQDGSYFRDLWNILDFIVVVGALMAFALANALGTNKGRDIKTIKSLRVLRVL
RPLKTIKRLPKLKAVFDCVVTSLKNVFNILIVYKLFMFIFAVIAVQLFKGKFFYCTDSSK
DTEKDCIGHYVDHEKNTMEVKCRKWKRHEFHYDNIMWALLTLFTVSTGEGWPQVLQHSVD
VTEEDRGPSRSNRMEMSIFYVVYFVVFPFFFVNIFVALIIITFQEQGDKMMEECSLEKNE
RACIDFAISAKPLTRYMPQNRHTFQYRVWHFVVSPSFEYTIMAMIALNTVVLMMKYYSAP
YTYELALKYLNIAFTMVFSLECVLKIIAFGFLNYFRDTWNIFDFITVIGSITEIILTDSK
LVNTSSFNMSFLKLFRAARLIKLLRQGYTIRILLWTFVQSFKALPYVCLLIAMLFFIYAI
IGMQVFGNIKLDEESHINRHNNFRSFLGSLMLLFRSATGEAWQEIMLSCLEGKGCESDTT
ATSGQNENERCGTNLAYVYFVSFIFFCSFLMLNLFVAVIMDNFEYLTRDSSILGPHHLDE
FVRIWAEYDRAACGRIHYTEMYEMLTLMSPPLGLGKRCPSKVAYKRLVLMNMPVAEDNTV
HFSSTLMALIRTALDIKIAKGGADWQQLDSELQKEILTIWPHLSQKMLDLLVPMPKTTDL
TVGKIYAAMMIMDYYKQSKAKKQRQQLEEQKNAPMFQRMEPSSLPQEIISNAKALPYLQQ
DTISGLSSRSGFPSLSPLSPQEIFQLACMDPSHGEYQEQQSLEPEVREFKRVQPSNCGSY
LPVDTQERAVSGRASSMPRLTVDPQVVTDPGSMRRSFSTIRDKRTNTSWLDEFSMEKSSE
NTYKSRRRSYHSALHLSSRRLNTDSGKWEQE
NT seq 6576 nt   +upstreamnt  +downstreamnt
atgatgttcagccttggcacatgctctctcagcgctcacatgctccccgaatcaggctct
taccctcctggcggcagccctgaactggacagcgactcgcagaggtgcatgctggccctg
ccggaggaagaagcatggcggaagcaccggctgggtttgatgcagcccgctcagtcctgc
agcctgctggagccagagaccttgacggacacgctcgtctcgcgcaccaccagcttcgac
ggcctctacgaactgcgctcccaggagagggaatccagtttggggttggagggcggcagc
acgttggacgtggggcagagccaactcattcccgtgagcccagaagtcatcaagcgccgg
cgagggggcctgattgaacagcgagatatcatcaaggcgcacgaagcccacaagatgcag
agcacgccgcaggcgaggcggaaggagtgggagatggctcgctttggagaggcgatggct
ggcaggctgggatccggagatggagctgccgagcagaacaggaaccgccagggagccccg
gcccctccgggggggaccccggtagcgtacaagcaaaccaaagcccaacgggccaggact
atggcactgtacaaccctatacccgtccgtcagaactgcttcacagtcaacagatctctc
ttcatttttggggaagacaacattgtcaggaaatatgccaagaagctgatcgactggcct
ccttttgaatacatgattctggcaaccatcatcgcaaactgcatcgttctggccctggaa
cagcaccttcctgaagacgacaagacacctatgtctcggagattagagaagacagaacct
tatttcattgggatcttttgctttgaagctggcattaaaatagtcgctttgggattcgtt
ttccacaagggctcctatttacggaacggatggaatgtcatggatttcattgtggtcctg
agcggcatcctcgccacagcagggacccatttcaacacccatgtggacctgaggacgctg
cgggcagtgcgagtgctcagacccttgaagcttgtctcaggcattcctagtttacagatt
gtgctcaaatccatcatgaaggcaatggtgcctctcctgcagattggtctcctcctcttc
ttcgccatcctgatgtttgccatcattggcctggagttctacagcggaaagcttcaccgg
gcttgctacgtaaacaattcaggtgaattgcaagagttggacccgcctcatccctgtggg
gtgcagggatgccctgcaggttatgagtgcagagagtggattggtcccaacgacgggatc
acccagtttgacaacatcctctttgctgtgttgactgtcttccagtgcatcaccatggaa
ggatggactacagtgctgtacaataccaatgatgccttaggagccacctggaactggctg
tactttatccccctcatcattattggatctttctttgttctcaacctcgtccttggagtg
ctttctggggaatttgccaaagagagagagcgagtggaaaatcgccgggccttcatgaaa
ctgaggaggcagcagcagattgaacgggagctgaacggctaccgggcttggatagataaa
gcagaggaagtcatgctggctgaagagaacaagaattctggcacatcggcattagaagtt
ctcaggagggcgaccattaaaaggaaccggacagaagtcatgaatcgtgactccagtgat
gagcgtgtggatatctcctctgtgggcacccccctcgctcgggccagcatcaagagcgcc
aaactggatggcgcctcgtatttccgacacaaggagcggctcctgcgcatctctgtccgc
cacatggtgaaatcccaggtgttctattggctcgtcttgagcatcgtggccctcaacacg
gcctgtgtggccatcgtccatcacagccaacctccttggctcacacacctcctctactat
gcagagtttatatttctgggcctcttcctcctagagatgtccttgaagatgtacgggatg
gggccccgactttatttccattcttctttcaactgctttgactgtggggtcacggtggga
agcatcttcgaagtggtttggacgatcttcagacctggaacctcttttgggattagcgtc
ttacgagccctgcggcttctaaggatatttaaaatcacaaagtattgggcttccttgagg
aatttggtggtctcactgatgagttctatgaagtctattatcagcctcctcttcctcctt
ttcctcttcattgtagtctttgccctgcttgggatgcagctctttggtggcagatttaat
tttatggatgggactccttctgcaaactttgacaccttccctgcagccatcatgacagtt
ttccagattttgacaggggaagactggaatgaagtgatgtacaatggaattcgctcccaa
ggtggcgtcagctcaggaatgtggtcgtccatctacttcatcatcctcacgctatttgga
aactataccctgcttaatgttttcttggccattgctgtggataacctagctaatgcgcag
gagctgacaaaggatgagcaggaagaagaagaggcttttaatcagaagcacgccttgcag
aaagccaaggaagtcagtccaatgtctgctcccaacatgcctgctatagaaagagacaga
aggaggagacaccacatgtcgatgtgggaaccgcgcaccagcaacctgagggagaggaga
aggaggcatcatatgtctgtgtgggaacagcggaccagccagctgcgccgccacatgcag
atgtccagccaggagggcatcaacaaggacgacccttctctgctcaaccctcatgccaac
gcttttcggaggagaaggctgctggagaacagtggcctcgaaaagaacgaggaggagcgg
acggaaaagtcagagcgggcaaacgaagaagggacggccctgcaaatcccaggttccaat
ccctgcccaggcagcatggaagaccagaagagcgtgtggcaccacaaatccttccacggg
aactgcgatctgaacgagcaggaaggcggagcgagcgtgacctttgaggacagggcccgg
ctcaggcaaagccagaggcgcagccgacatcgcagggtgaggacggaagccaaggagaac
aggtcggccagccaagaggccggccccgaagcggtcagccccgcagagggagagcagaac
caggagcagaagaagaacgaggaggaaaaggagggcttgatcgaaaaggagccggtggtt
ggcgaggagctgaaaaggaccaatgaagccccagccaaagatgccgagtttgcagcggcc
ccccaagagccaagcccctcggaaggccaccttgagctggacaaaggcaaggatgctagt
ccaactgagcaggatggcagcagcttggatacaagtgagcaggcgctcctgggggacctg
cccatggagacaggcaggactatcagcaggagtgagcccgatctctcctccgtcacaacc
aacatggagaaagccaccgagagcaccaccatcatgattgacgtccaagactctgctgtg
gtacagattagcaacaagacagatggagaagccagccctttgaaggaggcagagacaaag
gaagaggaggaagcagaggcagagaagaagaagaagaagcagaaaaagaagaaacccgta
ggcaaacccatggtgcctcacagctcgatgtttatcttcagcaccacaaacccaatccga
agagtctgccattacattgtcaacctgcgctattttgagatgtgcatccttctggtgatt
gcagcaagcagcattgccttggcagcggaggaccccgtcctgaccaactccgagaggaat
aaagtcctgagatatttcgactatgttttcactggcgtcttcacctttgagatggttatc
aagatgatagatcagggattaatcctgcaagacggctcctatttccgagatctctggaac
atcctggacttcattgtggtggttggagccctgatggcctttgccttggcgaatgctttg
gggacgaacaaaggtcgggacataaaaactattaagtctctgcgtgttctgcgagtcttg
aggcctttgaagaccatcaagaggctgcccaaactcaaggccgtctttgactgcgtcgta
acttcgttgaagaacgtcttcaacatcctcattgtctacaagctcttcatgttcatcttt
gcggtcatcgcagttcagctcttcaagggcaaattcttctattgtacggacagttcaaaa
gatacagagaaagactgcataggccactatgtggaccacgagaaaaacacgatggaagtg
aaatgccgaaaatggaagcgccacgaattccactacgacaatatcatgtgggctctgctt
accctcttcactgtctccaccggagaggggtggccgcaggttctgcagcattcggtggat
gtgactgaggaggaccgcggccccagccgcagcaaccgcatggagatgtccattttctat
gtggtgtattttgtggtcttcccttttttctttgtgaacatctttgtggctctcatcatc
atcactttccaggagcaaggagacaaaatgatggaggagtgcagcctcgagaagaacgag
agagcatgcattgactttgccatcagtgccaaacccctcacccgctacatgccgcaaaac
cggcacacctttcagtaccgggtctggcactttgtggtctccccatcgtttgagtacacc
attatggcgatgatagcactgaacactgtggttctaatgatgaagtactattctgctccc
tacacctacgaactagctctgaagtacctgaacattgcttttaccatggttttctcactg
gaatgtgtcctgaaaattatagcttttggctttctgaattatttccgcgacacctggaac
atctttgatttcatcaccgtgattggcagcattacagaaattatcttgacggacagcaag
ctggtcaataccagcagcttcaacatgagctttctgaagttgttccgggctgcccgtctc
atcaaattgcttcgccaaggttacaccatccgcattctgctgtggacttttgtgcagtcc
ttcaaggccctcccctacgtctgtctcctgattgcaatgctcttcttcatttacgccatc
attgggatgcaggtttttgggaatatcaaactagatgaagaaagccacattaatcgtcac
aacaatttccgcagctttctgggctcactgatgcttcttttcaggagcgccacaggggag
gcgtggcaggagatcatgctttcatgcctggaagggaaaggatgtgagtcggacaccaca
gcaacatctgggcagaacgagaacgagcgatgcggcacaaatctggcatacgtatacttt
gtctcctttatcttcttctgctcctttttgatgctcaatctctttgtggctgtcatcatg
gacaattttgaatacctgactcgagattcctccatcttgggaccgcatcaccttgacgaa
tttgtccggatttgggcagagtacgacagagctgcgtgtggccgcatccattacactgag
atgtatgaaatgctgactctcatgtccccaccactaggcctcgggaagagatgtccctcc
aaagttgcttataagaggctggtcctgatgaatatgccggtggccgaggacaacaccgtc
catttctcctccaccttgatggccctcattcgaacagctttggacattaagattgctaaa
ggtggtgcagattggcaacagctggactccgagctccagaaagagattttgaccatctgg
cctcacctttcacagaagatgctggacctgttggtgcctatgccaaaaactacggacctg
acagttggaaaaatctatgcagccatgatgataatggactattataagcagagtaaagct
aaaaaacaaaggcagcaactggaagaacagaaaaatgccccaatgttccagcgcatggag
ccttcctctcttcctcaggagatcatttctaatgccaaagctttgccttacctccagcaa
gataccatttcaggactgagcagcaggagcgggttcccttccctgagcccactctctccc
caagagatattccagctggcttgcatggatccgtcccatggggaatatcaagagcagcaa
tctctggagccagaggttagagagtttaaaagagtgcagccctctaactgtggcagctac
ctcccggtggatactcaggaacgagctgtatctgggagggcctcttccatgccacgcctg
actgtggatccccaggtggttacagatccaggctccatgagacgctccttttctactatt
cgagacaagcggacgaacacctcctggttagatgagttctccatggaaaagagcagtgaa
aacacctacaagtctcgccggcgcagttaccattctgcactgcacctctcttcaaggcgc
ctcaacacagattcaggtaaatgggaacaggagtga

DBGET integrated database retrieval system