KEGG   Podarcis muralis (common wall lizard): 114599215
Entry
114599215         CDS       T06059                                 

Gene name
CDKN1A
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1 isoform X1
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
pmua  Podarcis muralis (common wall lizard)
Pathway
pmua04012  ErbB signaling pathway
pmua04068  FoxO signaling pathway
pmua04110  Cell cycle
pmua04115  p53 signaling pathway
pmua04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:pmua00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    114599215 (CDKN1A)
   04068 FoxO signaling pathway
    114599215 (CDKN1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    114599215 (CDKN1A)
   04115 p53 signaling pathway
    114599215 (CDKN1A)
   04218 Cellular senescence
    114599215 (CDKN1A)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 114599215
NCBI-ProteinID: XP_028589833
LinkDB
Position
6
AA seq 155 aa
MGSVGFGAGNMPLSKGNLLRSPCSRKLCRNLFGPVDHDQLQKDFQSLMKAQLEEAQQKWN
FDFESETPLEGDYKWEKVSHLSRLPSQDLLSPTKENSCAGEKSLSSSPVLLKMHTKTDRP
TQVGFEARKSSKRKQTTIKDFYSSKRRTVPCKSDP
NT seq 468 nt   +upstreamnt  +downstreamnt
atgggttcggtcggttttggggctggaaacatgcctctgtctaagggcaacctccttcgg
tctccctgcagcaggaagctttgcagaaacctctttggaccagtcgatcatgaccagctt
caaaaggacttccagtccttgatgaaggcccagctggaggaggctcagcagaagtggaac
tttgactttgaatcggaaactccacttgaaggggactataaatgggaaaaggtctctcat
ctaagcaggttgccttctcaagatctgctgagccccacaaaggaaaacagttgtgccggt
gaaaagagcttgagctcctccccagtgcttctcaagatgcacacaaagacagacaggcca
acgcaagtgggctttgaggctcgcaagtcttccaagcgaaagcagacaactatcaaagac
ttctacagctccaagcggagaactgtcccctgcaagtcagacccatga

DBGET integrated database retrieval system