KEGG   Podarcis muralis (common wall lizard): 114600173
Entry
114600173         CDS       T06059                                 

Gene name
TRAF6
Definition
(RefSeq) TNF receptor-associated factor 6
  KO
K03175  TNF receptor-associated factor 6 [EC:2.3.2.27]
Organism
pmua  Podarcis muralis (common wall lizard)
Pathway
pmua04010  MAPK signaling pathway
pmua04120  Ubiquitin mediated proteolysis
pmua04140  Autophagy - animal
pmua04144  Endocytosis
pmua04620  Toll-like receptor signaling pathway
pmua04621  NOD-like receptor signaling pathway
pmua04622  RIG-I-like receptor signaling pathway
pmua05132  Salmonella infection
pmua05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pmua00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    114600173 (TRAF6)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114600173 (TRAF6)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    114600173 (TRAF6)
   04140 Autophagy - animal
    114600173 (TRAF6)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    114600173 (TRAF6)
   04621 NOD-like receptor signaling pathway
    114600173 (TRAF6)
   04622 RIG-I-like receptor signaling pathway
    114600173 (TRAF6)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    114600173 (TRAF6)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    114600173 (TRAF6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pmua04131]
    114600173 (TRAF6)
   04121 Ubiquitin system [BR:pmua04121]
    114600173 (TRAF6)
Enzymes [BR:pmua01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     114600173 (TRAF6)
Membrane trafficking [BR:pmua04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    114600173 (TRAF6)
Ubiquitin system [BR:pmua04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    114600173 (TRAF6)
SSDB
Motif
Pfam: zf-TRAF zf-C3HC4_2 zf-C3HC4 zf-RING_UBOX zf-C3HC4_3 zf-RING_2 zf-C3HC4_4 Med21 SlyX zf-TRAF_2 zf-RING_5 TRAF6_Z2 DUF4455 Cast zf-RING_11 Tropomyosin_1 U-box DUF16 UPF0242 TMF_DNA_bd MATH rRNA_proc-arch TMF_TATA_bd Spc7 Spc29 HMMR_N PspA_IM30 DUF1664 Cortex-I_coil
Other DBs
NCBI-GeneID: 114600173
NCBI-ProteinID: XP_028591838
LinkDB
Position
7
AA seq 535 aa
MSLLHSNNSSFEASGQDSGCCAAMASCSIAGAKEKSINTSVSNGTGGTLSNSFMEEIQGY
DVEFDPPLESKYECPICLMALREAVQTPCGHRFCKACIVKSIRDAGHKCPIDNEILLETQ
LFPDNFAKREILSLTVKCPNKGCHQKMELRHLEDHELHCGFAPEKCPQCHAIFQKNQIQD
HIKQECPRRQTSCPNCAVWMPYEEKEVHDQMCLLANVCCEYCNTVLIREQLPNHYDNDCP
TAPVPCTYSPFGCPEKMQRNELARHMQEFTPVHMRMMAQTLLNITNFHGAIPYDPSPSCE
CSPEVHNFKETIQQLEGRLVRQDHQIRELIAKMETQNNQMRDLKRTIRNLEEKVAEVESQ
QCNGIFLWKIENFSVYLRAQEEDRPVVIHSPGFYTGKPGYKLCLRLHIQSPNAQRCANYI
SLFVHTMQGQYDSHLPWPFQGTIRLSILDQSEGSSRHNHEEVMDTKPELLAFQRPMVDRN
PKGFGYVTFMQLQALKQKNYIKDDSILVRCEVITRLDLNSLRREGFQPRSTDGAA
NT seq 1608 nt   +upstreamnt  +downstreamnt
atgagtctgctacacagtaacaacagcagctttgaagccagtggtcaggatagcggctgc
tgtgcagctatggccagctgttccattgctggagccaaagaaaaaagcatcaacaccagt
gtcagcaatggcactgggggaacactttcaaactctttcatggaagaaatccagggctat
gatgtggagtttgatcctccgctggaaagtaaatatgaatgcccaatctgtctgatggct
ctccgggaagcagtgcagacaccatgcggacaccgtttctgcaaagcttgcattgtcaaa
tccataagagatgctggtcataaatgtccaatcgacaacgaaattttactcgaaactcaa
ctctttcctgacaactttgcaaaacgggaaatcctatcgctgacggtgaagtgtcccaac
aagggctgtcatcagaagatggaactcaggcatttagaggaccatgagctgcattgcggc
tttgctccagagaaatgtccccagtgccatgccattttccaaaagaatcagatacaggat
catataaagcaagaatgtccacgacgacaaacctcctgtccaaactgtgctgtgtggatg
ccttatgaagaaaaagaggttcatgaccagatgtgccttttagcaaatgtctgctgtgaa
tactgcaatacagtgctaatcagagaacagcttcctaatcactacgataacgattgccca
actgctccagtaccgtgtacatacagcccctttggatgtccagaaaaaatgcagagaaat
gagttggcacggcatatgcaggagttcaccccagtccatatgagaatgatggctcagact
ctcctgaatatcactaatttccatggcgctatcccatatgacccatcaccttcctgtgaa
tgtagcccagaggtccacaacttcaaggagacgattcaacaactggaaggtcgcttggta
aggcaagatcaccagatccgagaactcatagcaaagatggagacacaaaacaaccagatg
agagatctcaaacgcactatccgaaatctggaggaaaaagtcgcagaagtggaatcacag
cagtgtaatggtattttcctgtggaagattgagaatttcagtgtttacttgagagcgcag
gaggaagataggcctgttgtaatccacagcccaggcttctacacagggaaacccggctac
aaactctgcttgcggctgcatatccagtccccgaatgcacagcgctgtgccaactatatt
tccctttttgttcatacgatgcaagggcaatatgacagccacctgccttggcccttccaa
ggcaccatacggctttctatcctggatcagtcagaaggatcgtcaaggcacaaccacgag
gaagtgatggataccaagcccgagctgcttgctttccagcgccccatggtcgaccgcaac
ccaaaaggctttggatatgtgacgtttatgcagttgcaggcgctaaaacaaaaaaactat
ataaaggacgatagtatcctagtgcgctgtgaggtcataacacgcttagacttaaacagt
ctccgaagggagggttttcagcctcgtagtactgatggggcggcatag

DBGET integrated database retrieval system