KEGG   Podarcis muralis (common wall lizard): 114600980
Entry
114600980         CDS       T06059                                 

Gene name
BCL2
Definition
(RefSeq) apoptosis regulator Bcl-2
  KO
K02161  apoptosis regulator Bcl-2
Organism
pmua  Podarcis muralis (common wall lizard)
Pathway
pmua04115  p53 signaling pathway
pmua04140  Autophagy - animal
pmua04141  Protein processing in endoplasmic reticulum
pmua04210  Apoptosis
pmua04217  Necroptosis
pmua04261  Adrenergic signaling in cardiomyocytes
pmua04340  Hedgehog signaling pathway
pmua04510  Focal adhesion
pmua04621  NOD-like receptor signaling pathway
pmua05132  Salmonella infection
pmua05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pmua00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    114600980 (BCL2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    114600980 (BCL2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    114600980 (BCL2)
  09143 Cell growth and death
   04210 Apoptosis
    114600980 (BCL2)
   04217 Necroptosis
    114600980 (BCL2)
   04115 p53 signaling pathway
    114600980 (BCL2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    114600980 (BCL2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    114600980 (BCL2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    114600980 (BCL2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    114600980 (BCL2)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    114600980 (BCL2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pmua01009]
    114600980 (BCL2)
Protein phosphatases and associated proteins [BR:pmua01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     114600980 (BCL2)
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Other DBs
NCBI-GeneID: 114600980
NCBI-ProteinID: XP_028593704
LinkDB
Position
7
AA seq 232 aa
MMAQTGIRGYDTREIVQTYIHYKLSQKGYDWVASEDREDLPSPPLPPDPPAAETFPNLAR
LASHPSELPVSNVAPAGGPHPVPQVVHATLRQAGDEFSRRYRRDFAQMSGQLHLTPVTAR
ARFAAVVEELFRDGVNWGRIVAFFEFGGMMCVESVSREMSPLVDNITVWMTDYLNGHLDN
WIQDNGGWDAFVELYSNNMRPLFDFSWLPLKTILSLAVVGACITLGAYLGHK
NT seq 699 nt   +upstreamnt  +downstreamnt
atgatggctcagactgggataagaggttacgacacaagagagatagtgcagacgtacatc
cattacaagctgtcgcagaagggatatgactgggttgccagtgaagacagagaagacctt
ccttctcctcctcttcctccagatcctcctgctgcagagaccttccctaaccttgctagg
ctggcatctcatccttccgagctgcctgtaagtaacgtcgccccggctggcggaccgcac
cctgtgccacaggttgtccacgcgactttacgtcaagccggggatgagttttcgcggcgt
tacaggagggactttgctcagatgtctggacagctgcacttgaccccggtcactgccaga
gctcgctttgcggcagttgtcgaagagctcttccgagacggggtgaactgggggaggatt
gtggcgttctttgagttcggtggcatgatgtgcgtggagagcgtcagccgggagatgtcg
ccccttgtggacaatatcacagtgtggatgactgactacctgaacgggcacctggacaac
tggatccaagacaatggaggctgggatgcttttgtggagctctacagcaacaacatgagg
cctttgttcgatttctcgtggctgcctctgaagacaattctgagtctggctgttgtgggt
gcctgcatcacccttggagcttatctggggcataagtga

DBGET integrated database retrieval system