KEGG   Podarcis muralis (common wall lizard): 114601905
Entry
114601905         CDS       T06059                                 

Gene name
TRADD
Definition
(RefSeq) tumor necrosis factor receptor type 1-associated DEATH domain protein
  KO
K03171  tumor necrosis factor receptor type 1-associated DEATH domain protein
Organism
pmua  Podarcis muralis (common wall lizard)
Pathway
pmua04010  MAPK signaling pathway
pmua04210  Apoptosis
pmua04217  Necroptosis
pmua04622  RIG-I-like receptor signaling pathway
pmua04920  Adipocytokine signaling pathway
pmua05132  Salmonella infection
pmua05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pmua00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114601905 (TRADD)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    114601905 (TRADD)
   04217 Necroptosis
    114601905 (TRADD)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    114601905 (TRADD)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    114601905 (TRADD)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    114601905 (TRADD)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    114601905 (TRADD)
SSDB
Motif
Pfam: TRADD_N Death
Other DBs
NCBI-GeneID: 114601905
NCBI-ProteinID: XP_028595367
LinkDB
Position
8
AA seq 339 aa
MGDVSDVWVGSAYLFVQSTSENILLPVMYGDPKQKPCVFKALKLALADSTGSLNGVDVLK
VHCSDPHLIIQLKFCKEENCRRFLQSYREGHLQDSLQNHLKLSLSMSTLVPVQMELKTGA
EKLDAMIREEERCLECIYHEKPNRLRDEEITELEESLRNCSFLDKIDNTGPSSNSSHAPL
NSSPASLNSSPPSLNSPPPSLNSSPPSLNSLPQSYSSVEISGSLPKGDTFTFQGQQFANR
KISPDDHQTFAKLVSKKWKQVGRSLQVNCRALRDPVIDNLAIEYDREGLYEQAYQLLRRF
IDSEGKRATIERLVAALEENGLISLAEELLSVHQNDKTL
NT seq 1020 nt   +upstreamnt  +downstreamnt
atgggagacgtctctgatgtttgggtgggaagcgcctacctgtttgtgcagtcaacatca
gaaaatatccttcttcctgtgatgtatggagacccaaagcagaagccctgcgtgttcaaa
gcactcaagttggcactagcggattcaacgggtagcctcaacggggtagatgtgctgaag
gtccattgcagcgaccctcacctgataatccagctcaaattctgcaaggaagagaactgc
cggagattcctgcaaagctatcgtgaaggacacctccaagactccctccagaatcacctc
aaactttccttgtccatgtccaccttagtccctgtccagatggagctgaaaactggcgcc
gagaagctggacgccatgatccgggaggaggagcggtgccttgaatgcatctaccatgaa
aagcctaaccgtctcagggatgaagagatcacagaactggaggaatctctcaggaactgt
tcgtttctggacaagattgacaacacgggtccttcttcaaattcttcacatgcacctttg
aattcttcacctgcatctttgaattcttcacctccatctttgaattctccgcctccatct
ttgaattcttcgcctccatctttgaattctttgcctcaatcttacagttctgtggagatc
tcagggtctctgccaaagggagacaccttcactttccagggccagcagttcgccaacaga
aaaatctctccagacgaccaccagacgtttgccaaactcgtgtccaagaagtggaagcag
gtgggccggtctctgcaggtcaactgccgggcccttcgggatcctgtcattgacaacttg
gccatagagtacgaccgggagggcctctatgagcaagcgtaccagcttctccgcaggttc
attgactcagaaggcaagagagccaccatagaaagactggttgccgccctggaggagaat
ggcctcatcagcttggctgaggagcttctgagtgtccaccagaatgacaaaacactgtaa

DBGET integrated database retrieval system