KEGG   Podarcis muralis (common wall lizard): 114602973
Entry
114602973         CDS       T06059                                 

Gene name
TGFA
Definition
(RefSeq) protransforming growth factor alpha
  KO
K08774  transforming growth factor, alpha
Organism
pmua  Podarcis muralis (common wall lizard)
Pathway
pmua04010  MAPK signaling pathway
pmua04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:pmua00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114602973 (TGFA)
   04012 ErbB signaling pathway
    114602973 (TGFA)
SSDB
Motif
Pfam: EGF EGF_2
Other DBs
NCBI-GeneID: 114602973
NCBI-ProteinID: XP_028597534
LinkDB
Position
8
AA seq 363 aa
MLPVGLPQLKRNETEAFKGCFPAARPPPGGSRGRTSSCSDVQPLPGGCPSPPSARGALLQ
GVPGAGAATPPGGRGREAGAAPGGGADAARRLGHSGPRSAPGRSRAERSAPTPLLARSLA
RPPARPTAREGAGCCSARRRCIAADRPAPPARPPKGLHAGPAGNARRRRRRRGPRAGQLS
PPTPPLLPPFPPLLLLLLGWPGKMVGAAAAEVALLTLGIVLAVCQAVENTTSALSGPPVA
AAVRSHFNSCPDAHSEFCFHGTCRFLVQEEKPACVCHSGYVGARCEHADLLAVVAANQTK
QTITALVVVSVIASVALIMVCVLIHCCRIRKHCEWCRTVVCRHEKPNGLLKGGTSCCHSE
TVV
NT seq 1092 nt   +upstreamnt  +downstreamnt
atgttgcctgttgggttgccccagctgaaacgaaatgaaacagaggcattcaagggatgc
tttcccgcagcgcgaccacctcctggcggatcgcggggacggacttccagctgttccgac
gtgcagcctctccctggcggctgcccgtcgccgcctagcgcccgcggggcgcttctgcag
ggcgtcccgggggccggagccgccaccccgcccggggggcgtgggagggaggccggcgca
gcgccaggaggaggggcggacgctgctcgccgcctcggccactcggggccgcgcagcgca
cctggaaggagccgcgccgagaggagcgcaccgacgcccttgctcgctcgctcgctcgcc
cgcccgcctgcgcgtccgacggcccgggaaggcgctggctgctgctccgcccggcgcagg
tgcatcgctgccgaccggcccgcgcctcccgctcgccctccgaaggggctccacgccggc
cccgccgggaatgctcgacgccgccgccgccgccgggggccgagggctggccagctgagt
ccaccgacgccgccgctgctgccgccgttcccccccctcctcctcctcctcctcggctgg
ccgggcaagatggtcggcgcggcggccgccgaggtggccctcctgaccctcggtattgta
ttagctgtgtgccaggccgtggagaacacaacgtccgccttgagtggtccgccagtggct
gctgctgtgagatctcattttaacagctgtccagatgctcatagtgagttttgcttccat
ggtacttgcaggtttttggtgcaagaggaaaaaccagcttgcgtctgccattccgggtac
gttggggcgcgatgcgaacacgcggacctccttgcagtggtggccgccaaccagacaaag
caaaccatcactgccctggtggtggtttccgttatagcctccgttgcccttatcatggtc
tgcgtcctaatacactgctgtaggatacggaaacactgcgagtggtgcagaactgttgtc
tgcagacatgagaagcccaacgggctcctgaaaggaggaacgtcttgctgccattcagag
acagttgtctga

DBGET integrated database retrieval system