KEGG   Podarcis muralis (common wall lizard): 114603303
Entry
114603303         CDS       T06059                                 

Gene name
IL1B
Definition
(RefSeq) interleukin-1 beta
  KO
K04519  interleukin 1 beta
Organism
pmua  Podarcis muralis (common wall lizard)
Pathway
pmua04010  MAPK signaling pathway
pmua04060  Cytokine-cytokine receptor interaction
pmua04217  Necroptosis
pmua04620  Toll-like receptor signaling pathway
pmua04621  NOD-like receptor signaling pathway
pmua04623  Cytosolic DNA-sensing pathway
pmua04625  C-type lectin receptor signaling pathway
pmua05132  Salmonella infection
pmua05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pmua00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114603303 (IL1B)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    114603303 (IL1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    114603303 (IL1B)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    114603303 (IL1B)
   04621 NOD-like receptor signaling pathway
    114603303 (IL1B)
   04623 Cytosolic DNA-sensing pathway
    114603303 (IL1B)
   04625 C-type lectin receptor signaling pathway
    114603303 (IL1B)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    114603303 (IL1B)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    114603303 (IL1B)
Cytokines and growth factors [BR:pmua04052]
 Cytokines
  Interleukins
   114603303 (IL1B)
Glycosaminoglycan binding proteins [BR:pmua00536]
 Heparan sulfate / Heparin
  Cytokines
   114603303 (IL1B)
SSDB
Motif
Pfam: IL1 IL1_propep
Other DBs
NCBI-GeneID: 114603303
NCBI-ProteinID: XP_028598015
LinkDB
Position
8
AA seq 267 aa
MSRVPECEEEVMDFCSVDEMQFYEEDRPSLAKETFPGLSHPACKVGIQVKIANSSSSLGF
QKAAIIMVAIERMKKKKSSKARALFTDDDLMDIINSVLEPVDFDTCECTYATDPIYHLSR
SISCNIRDVNQKSLVLNGTTQLVALELQQADISKEARVKMYVYRPKIGEGIAKIPIALKI
KGKELYLSCVQSGDQPALQLEEASIEGDLDKSDKGRFLFYRVAVGDYTRFESAAFPQWYI
CTSAQVNKAVSVTNRIGEVSIVDYIVT
NT seq 804 nt   +upstreamnt  +downstreamnt
atgtctagagtgcctgaatgcgaagaggaggtgatggacttctgcagtgtggacgagatg
cagttctacgaagaggaccggccttctctggccaaggagaccttcccagggctgagccat
cctgcctgcaaagtgggcattcaggtgaagatcgccaacagctcttcatctctgggcttc
cagaaggcagcgatcattatggtggcgattgagaggatgaagaagaagaagtcctccaaa
gccagggcgcttttcacagatgacgacctgatggacatcatcaattccgtcttagaacca
gttgactttgacacctgcgaatgcacctatgccacagatcccatctaccacctcagcagg
agcatctcctgcaacatcagagacgtcaaccagaagtcccttgtcctgaacgggacaacc
cagctggtggccttggagctccaacaggcagacatcagcaaagaagcaagggtgaaaatg
tacgtctatcgaccaaaaatcggagaaggcatagcgaagatccccatcgccctgaaaatc
aaagggaaggaactgtacctgtcttgcgtgcagagcggagaccagccagcacttcagctg
gaggaggccagcatcgaaggggacctcgacaaatccgacaaagggcgcttcctcttctac
agagttgcagttggggactacaccaggttcgagtcagctgcctttcctcagtggtacatc
tgcacatctgcccaggtcaacaaagctgtcagcgtgacaaaccggattggggaggtctcc
atcgtggattatattgtcacataa

DBGET integrated database retrieval system