KEGG   Podarcis muralis (common wall lizard): 114604335
Entry
114604335         CDS       T06059                                 

Gene name
PDGFRA
Definition
(RefSeq) platelet-derived growth factor receptor alpha isoform X1
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
pmua  Podarcis muralis (common wall lizard)
Pathway
pmua04010  MAPK signaling pathway
pmua04020  Calcium signaling pathway
pmua04144  Endocytosis
pmua04510  Focal adhesion
pmua04540  Gap junction
pmua04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:pmua00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114604335 (PDGFRA)
   04020 Calcium signaling pathway
    114604335 (PDGFRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    114604335 (PDGFRA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    114604335 (PDGFRA)
   04540 Gap junction
    114604335 (PDGFRA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    114604335 (PDGFRA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pmua01001]
    114604335 (PDGFRA)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:pmua04090]
    114604335 (PDGFRA)
Enzymes [BR:pmua01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     114604335 (PDGFRA)
Protein kinases [BR:pmua01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   114604335 (PDGFRA)
CD molecules [BR:pmua04090]
 Proteins
  114604335 (PDGFRA)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 V-set Herpes_gE
Other DBs
NCBI-GeneID: 114604335
NCBI-ProteinID: XP_028600205
LinkDB
Position
9
AA seq 1112 aa
MAACRKERGAVVETELSPPAKLMIVMGPSRRTILIVGCFLTGPWLASCQSLLPTILPNND
EMVVQLNSPFTLKCSGDSEVSWQHPITDGNHTIDLKSEENNSGLFVTVLDVANASASHTG
LYTCYYNHSQDEDGEVEGKDIYVFVPDPAVPFVPTFPEDEFIVITEEEESSTIPCRTSDP
NAQVTLMTSEKKIVYAFYDNRQGFIGNFSAGSYLCKTTVKGVEFLSSQFVIYIYKATSYL
HVEIESPKTVYKTGETIVVTCVVLDNEVVNLQWNYPGKVKNKGTISLDDIKIPTQKLVYN
LTIPDASVKDSGDYECAALHVTKDFKKTKKVVITVHDKGFIHLEPHFNPMEAVNLHEVKK
FVVDVHAYPEPKMFWLKDNVTLMENLTEIVTKSKQIQETRYQSLLKLIRAKEEDSGYYTF
VAQNEDETQRYIFSLLIQVPALIRDLVDSHHDSAGQTVTCLAEGTPLPDVEWLVCKDIKK
CSNDTSWTFLTNNISDIIMETHLDQKNMVESRVTFQKVEETLAVRCMARNDLGTVARELK
LVAPTLRSELTVAAAVLVLLVIVIISLIVLVIIWKQKPRYEIRWRVIESISPDGHEYIYV
DPMQLPYDSRWEFPRDGLVLGRILGSGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARS
SEKQALMSELKIMTHLGPHLNIVNLLGACTKSGPIYIITEYCFYGDLVNYLHKNRDNYLN
RHPEKPKKDLDIFGMNSADESTRSYVILSFENNGEYMDMKQAETMQYVPMLERKDRSKYS
DIQRSLYDRPASYKKKYVSELDVKNLLSDDNSEGLTLLDLLSFTYQVARGMEFLASKNCV
HRDLAARNVLLAQGKIVKICDFGLARDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTL
SDVWSYGILLWEIFSLGGTPYPGMMVDSMFYNKIKSGYRMAKPDHATSEVYDIMVKCWNS
EPEKRPSFYHLSEIVENLLPGEYKKSYERIHLDFLKSDHPAVTRMRADCDNTYIGVTYKN
EDKLKDRESGFDEQRLSADSGYIIPLPDIDPVSEDELSKRNRHSSQTSEESAIETGSSSS
TFVKREDETIEDIDIIDDIGMDSSELVEDSFL
NT seq 3339 nt   +upstreamnt  +downstreamnt
atggcagcttgtcgcaaagagaggggggcggtggtggaaacggagctttcgcctcctgcc
aagttgatgatcgtcatgggtccttcccgaagaacaatcctgattgtgggctgcttcttg
acagggccatggctagcctcttgccagtctttgcttccgactattctgccaaacaacgat
gaaatggttgtgcagctgaattcccccttcaccctgaaatgttctggagacagtgaagtc
agctggcaacatccaataaccgatggcaaccataccatagacctcaaaagcgaggagaac
aacagcggcctgtttgtgaccgtgcttgatgtggcaaatgcttctgcttctcacactgga
ttgtacacttgctactacaatcattctcaagatgaagatggtgaggtggaagggaaggac
atctatgtctttgtgccagatccagctgttccctttgttccgacattcccagaagatgag
ttcatcgtcatcaccgaagaagaagagtcctccaccatcccatgccggacaagtgacccc
aacgcccaagtaactttgatgaccagcgaaaagaaaatcgtgtatgccttttatgacaac
aggcagggcttcatcggaaacttctccgcaggctcctatctgtgcaagaccaccgttaag
ggagtggagttcctgtccagtcaatttgtcatctatatttacaaagctacatcatatctt
catgttgagattgaatcccccaagaccgtgtataagacaggagaaaccattgttgtaacg
tgtgtggtcttggataacgaagtcgtgaacctacagtggaattatccagggaaagtgaag
aacaaaggtacaatttcacttgatgacatcaaaattccaacccagaagctggtttacaac
ctgaccattccagatgcttcagtgaaggacagtggagattatgaatgtgctgctcttcat
gtgaccaaagattttaagaaaacgaaaaaagtcgtgatcacagttcatgataaagggttc
attcatctggaaccccattttaaccccatggaagctgtcaatcttcatgaagttaaaaaa
tttgtagttgatgtgcatgcatacccagagccaaaaatgttttggctgaaggacaatgtg
actctgatggaaaatctcacggagattgtcactaagtccaagcagatccaggagacgagg
taccagagtttattaaaattaatccgtgccaaggaagaagacagtggatattatactttt
gtagcacagaatgaggatgaaactcaaagatatattttctccctgctcatacaagttcca
gctttaattcgagatctggtggatagtcatcatgactctgcggggcaaacagtgacatgc
ttggcagaagggacaccactccctgacgtggaatggctggtttgcaaggacattaaaaag
tgcagtaatgacacctcatggaccttcctgacgaacaatatctctgatatcatcatggag
actcaccttgatcagaaaaacatggtagaaagccgggtgacctttcagaaggtggaagaa
acactggctgttcgctgtatggcgaggaatgacctcggcactgtggcacgggaactgaag
cttgtggctcccactttacgatcagaattgacggtggctgctgcagtcctagtgttgctc
gtaattgtaataatttcgctgattgtcctggtaatcatatggaagcagaaaccaagatat
gaaataagatggagagtcatcgagtccatcagcccggatggacatgaatacatttatgtg
gaccctatgcagctgccatatgactcaagatgggaatttccacgagatggattagtacta
ggacgaatccttggctctggagcttttgggaaagtagttgaaggaactgcttatggatta
agccggtcacagcctgtgatgaaggtggctgtgaaaatgttgaagcccactgcgagatcc
agcgaaaagcaggctcttatgtctgaattaaagataatgacccatcttggaccccacttg
aacatagtgaacttgttaggagcttgtacaaagtcaggtccaatttatatcataacggaa
tattgcttttatggagacttggtgaactacctgcataaaaatagggacaactatctgaat
cgacatcctgaaaagcccaagaaggacctggacatctttgggatgaactcagctgatgaa
agtactaggagctatgtaatcctatcctttgaaaacaatggtgaatatatggatatgaaa
caagcagagacgatgcagtatgtgccaatgctagaaaggaaagacagatcaaaatattct
gacatccaaaggtcactgtatgataggcctgcttcgtataagaaaaaatatgtgtcggaa
ctagatgtgaagaacctcctctccgatgacaattcagaaggcctcactttgttggacctg
ctcagcttcacataccaagttgcacggggaatggaattcttagcttctaaaaattgtgtt
caccgtgatttggcagcacggaatgtccttctggctcaaggaaaaattgtgaagatctgt
gactttggtctggctagagacatcatgcatgattcaaactatgtatctaaaggcagtacc
ttccttccagtgaaatggatggcacctgaaagcattttcgacaacctgtatacaacatta
agtgacgtctggtcttatggcattctgctgtgggaaatattttctcttggtgggactcca
tatcctggcatgatggttgattctatgttctataataaaattaaaagtggctaccgaatg
gcaaaaccggaccatgctaccagtgaggtgtatgacatcatggtgaaatgctggaacagt
gaacccgagaaaagaccttctttttatcacttgagcgaaatagttgagaacctgttgcct
ggagaatacaagaagagctatgagagaattcacttggacttcttgaagagtgaccatccc
gcggtcacacgcatgagagcggactgtgacaacacctacattggagtcacttacaagaat
gaagacaaactgaaggacagggagagtggatttgatgaacaaagactcagcgccgacagt
ggctacataatccccctgccggatattgaccctgtttcagaagacgaacttagcaaaagg
aacaggcacagttcccagacttctgaagaaagtgccatcgaaactggttccagcagctcc
acattcgtaaagcgagaggacgagaccattgaggatattgacatcatcgatgacattgga
atggattcctcagaactggttgaggacagtttcctgtaa

DBGET integrated database retrieval system