KEGG   Podarcis muralis (common wall lizard): 114605166
Entry
114605166         CDS       T06059                                 

Gene name
KITLG
Definition
(RefSeq) kit ligand isoform X1
  KO
K05461  KIT ligand
Organism
pmua  Podarcis muralis (common wall lizard)
Pathway
pmua04010  MAPK signaling pathway
pmua04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:pmua00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114605166 (KITLG)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    114605166 (KITLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pmua04052]
    114605166 (KITLG)
Cytokines and growth factors [BR:pmua04052]
 Growth factors
  Growth factors (RTK binding)
   114605166 (KITLG)
SSDB
Motif
Pfam: SCF
Other DBs
NCBI-GeneID: 114605166
NCBI-ProteinID: XP_028601909
LinkDB
Position
10
AA seq 283 aa
MKKAQTWIITCFYLQLLLLNPLIRAQSPCGNPVTDDVYDIAKLVGNLPNDYMITLKYVRK
MDSLPNHCWLYLMVPELSASLNNLLHRFKDFSDMSDVLSNYSIINNLTRIINDLMACLST
NKNKNFRKYNDHLYEEGKFFPEEFFKHFNSTIDVYKSIAKAPEQSDCVLLSATEPSPNDA
GNSVTEPILLHPVAASSLKNDSSGDSSEHAELGFLNSASMHGISIALTGLVTLLIGFLLG
ALCWKKTTRKHFSESDQNTESNICQEDNEISMLQQKEKILLQV
NT seq 852 nt   +upstreamnt  +downstreamnt
atgaagaaggcacaaacttggattatcacttgcttttatcttcagctgctcctccttaat
cctcttatcagagcccaaagtccctgcgggaatcctgtgacggatgatgtgtatgacatt
gcaaaactggttggaaatcttccaaatgattatatgataacccttaaatatgtccggaag
atggacagtctgcctaatcattgttggttgtatctgatggttcctgaattgtcagcgagt
ctgaataatcttctgcacagatttaaagacttttcagatatgtcagatgtcttaagtaat
tactcaatcatcaataatctcacaaggatcatcaatgatctaatggcatgcctgtctact
aataaaaataagaactttagaaaatataatgaccatctttatgaagaaggtaaattcttt
ccagaagagttctttaagcactttaatagcactattgatgtctacaaaagcattgcaaaa
gcaccagaacagagcgactgtgttctgctttcggcaacagagccctccccaaatgatgcc
ggcaacagtgtcacagagcccattttgttacatcctgttgctgccagctctcttaagaat
gacagcagtggcgatagcagcgagcacgcagagttgggtttcctcaacagtgccagcatg
catggaatcagcatagcactaacagggctggtgactcttcttattggctttcttttggga
gctctgtgctggaagaaaacaacccgcaaacacttttcagaaagtgaccagaatacagaa
tcaaacatctgccaagaggataacgaaataagtatgctgcagcaaaaagagaaaatactt
ctacaggtgtag

DBGET integrated database retrieval system