KEGG   Podarcis muralis (common wall lizard): 114605854Help
Entry
114605854         CDS       T06059                                 

Gene name
TIMP3
Definition
(RefSeq) metalloproteinase inhibitor 3
  KO
K16866  metalloproteinase inhibitor 3
Organism
pmua  Podarcis muralis (common wall lizard)
Brite
KEGG Orthology (KO) [BR:pmua00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pmua01002]
    114605854 (TIMP3)
Peptidases and inhibitors [BR:pmua01002]
 Peptidase inhibitors
  Family I35: timp family
   114605854 (TIMP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIMP Campylo_MOMP
Motif
Other DBs
NCBI-GeneID: 114605854
NCBI-ProteinID: XP_028603332
LinkDB All DBs
Position
10
AA seq 212 aa AA seqDB search
MSRCVLSLLVVLCSWSLSDLMLEACTCVPIHPQDAFCNSDIVIRAKVVGKKLMKDGPFGT
MQYTVKQMKMYRGFDKMPHVQYIYTEASESLCGVKLEVNKYQYLITGRVYDGKVYTGLCN
LNEKWDRLTLSQRKGLNHRYHLGCGCKIKPCYYLPCFVTSKNECLWTDMLSSFGQPGYQS
KHYACIKQKEGYCSWYRGWAPPDKTTINATDP
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgtccaggtgcgtgctgagccttctcgtggtgctctgcagctggagcctgagtgacttg
atgttggaagcttgtacctgcgtcccaattcaccctcaggatgctttctgcaactctgac
attgtcatcagagccaaggtagtgggcaagaagcttatgaaggatggaccttttgggacc
atgcaatatactgtcaaacaaatgaagatgtacaggggttttgacaagatgccacatgtt
caatatatctacacagaggcctctgaaagcctttgcggggtcaagctggaggtcaacaag
taccagtatttgattacaggccgagtttatgatggaaaggtttacacaggactgtgtaac
ctgaatgagaagtgggatcgactgactctctcccagcgcaaaggactcaaccatcgttac
caccttggttgtggctgcaagattaagccctgctactaccttccgtgctttgtgacctcc
aagaatgagtgcctgtggacagacatgctttccagcttcggccaaccagggtaccagtca
aagcattatgcctgcatcaagcagaaggagggctactgcagctggtacagaggatgggca
cctcctgataaaacaaccatcaatgccacagacccctga

DBGET integrated database retrieval system