KEGG   Podarcis muralis (common wall lizard): 114605885
Entry
114605885         CDS       T06059                                 

Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1C-like
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
pmua  Podarcis muralis (common wall lizard)
Pathway
pmua04010  MAPK signaling pathway
pmua04020  Calcium signaling pathway
pmua04260  Cardiac muscle contraction
pmua04261  Adrenergic signaling in cardiomyocytes
pmua04270  Vascular smooth muscle contraction
pmua04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:pmua00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114605885
   04020 Calcium signaling pathway
    114605885
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    114605885
  09153 Circulatory system
   04260 Cardiac muscle contraction
    114605885
   04261 Adrenergic signaling in cardiomyocytes
    114605885
   04270 Vascular smooth muscle contraction
    114605885
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:pmua04040]
    114605885
Ion channels [BR:pmua04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   114605885
SSDB
Motif
Pfam: Ion_trans GPHH Ca_chan_IQ CAC1F_C PKD_channel
Other DBs
NCBI-GeneID: 114605885
NCBI-ProteinID: XP_028603380
LinkDB
Position
10
AA seq 1925 aa
MVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCYVTESLSDTPAEEEPSPCAPVFAHGR
QCQNGTECRPGWEGPKHGITNFDNFAFAMLTVFQCITMEGWTDVLYWMQDAMGYELPWVY
FVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQA
EDIDPENEDEGMDEEKPRNKNTPAGLPDKKKGKFAWFSHSTETHVSMPTSETESVNTDNV
AGGDIEGENCGARLAHRISKSKFSRYWRRWNRFCRRKCRAAVKSNVFYWLVIFLVFLNTL
TIASEHYNQSDWLTEVQDTANKVLLALFTAEMLLKMYSLGLQAYFVSLFNRFDCFIVCGG
ILETILVETKIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLF
LFIIIFSLLGMQLFGGKFNFDEMQTRRSTFDNFPQSLLTVFQILTGEDWNSVMYDGIMAY
GGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQKEEEEEKERKKLA
RTASPEKKQEPEKPAVEGETKEEKIELKSITADGESPPSNKSNVDEYQPNENEEKNPYPT
TETPGEEEEEEPEMPVGPRPRPMSELHLKEKAVPMPEASAFFIFSPSNRFRVHCHRIVND
NVFTNLILFFILLSSISLAAEDPVRHTSVRNQILFYFDIFFTVIFTIEIALKILGNADYV
FTSIFTLEIILKMTAYGAFLHKGSFCRNYFNILDLLVVSVSLISFGIQSSAINVVKILRV
LRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKLYSCT
DSSKQTEAECRGNFITYKDGEVSQPIIQARSWENSKFDFDNVLTAMMALFTVSTFEGWPE
LLYRSIDSHMEDVGPIYNHRVEISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKN
CELDKNQRQCVEYALKARPLRRYIPKNQYQYKVWYVVNSTYFEYLMFILILLNTICLAMQ
HYGQSCIFKEAMNILNMLFTGLFTVEMVLKLIAFKPKHYFCDAWNTFDALIVVGSIVDIA
ITEVNPAEHTQCSSSMNAEENSRISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQA
LPYVALLIVMLFFIYAVIGMQVFGKIALNDTTDINRNNNFQTFPQAVLLLFRCATGEAWQ
EIMLACLPDKKCDPESLESNNSTEGEHSCGSSFAIFYFISFYMLCAFLIINLFVAVIMDN
FDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRV
ACKRLVSMNMPLNSDGTVMFNATLFALVRTALRIKTEGNLEQANEELRAIIKKIWKRTSM
KLLDQVVPPAGDDEVTVGKFYATFLIQEYFRKFKKRKEQGLVGKPSQRNALSLQAGLRTL
HDIGPEIRRAISGDLTAEEELDKAMKEAVSAASEDDIFRRAGGLFGNHVSYYQSDGRSSF
PQTFTTQRPLHINKSSSNQGDTESPSHEKLVDSTFTPSSYSSSGSNANINNANNTALSRF
PSPPSYPSTVSTVEGHGTPLSPTARIQEVPWKLGCRRTRTHYYETLGRSCSRDSQVAIVC
EEETCQEEEKYDEQLNEEIEYCGEPKLVPTEMLSCKDDEHRQLTPPENNIRYSPKSGFLH
SSSLSRRASFHLECLKRQKNQGTEVPQKTAVPLHVVHHQALAVAGLSPLLQRSHSPLRSS
RSCATPPATPCIQDWLQQPIKTLRLEGEESNEKLNNSFPSIHCSSLYSDSPSSSSTRKAR
PVSLTVPSQTRECGRQFHGSANSLVEAVLISEGLVQFAQDPKFIEVTTQELADACDLTIE
EMENAADNILNGNSKPSPNGNLLPFVNCRDPGQDCMGEKEETAQNPDCRKSQEEPKDSRI
YISSL
NT seq 5778 nt   +upstreamnt  +downstreamnt
atggtccctttgctgcacattgccctgctggtgctgtttgtcataattatctatgctatc
attggattggagctcttcatggggaagatgcacaagacttgttatgtaacagagagctta
tcagatacaccagcagaagaggaaccctctccttgtgcacctgtatttgcgcatgggcgg
caatgtcagaatggtactgaatgcagaccaggatgggaaggacctaagcatggcattacc
aacttcgacaattttgcctttgccatgttaactgtgtttcagtgcatcaccatggagggc
tggacagatgtgctatactggatgcaggacgctatgggctatgagttaccctgggtgtac
tttgtcagtctggtcatctttggatcctttttcgttcttaatctggttcttggtgtgttg
agcggggagttttctaaagagagagagaaagcaaaagctcgaggtgactttcagaagttg
cgagagaaacaacagctggaggaggacttgaagggatatctggactggataactcaagca
gaagatattgacccagaaaatgaagatgagggcatggatgaagagaagccccgaaacaaa
aacactccagctggcttgcctgataagaagaaaggaaagtttgcttggtttagtcactcc
acagaaactcatgtgagcatgcccaccagtgagacagaatctgtgaacactgacaatgtg
gctggaggagatattgaaggagaaaactgtggagcacggctggcgcaccggatatctaaa
tctaagtttagccgctactggcgtagatggaatcggttctgcagacggaaatgtcgagct
gctgtcaaatccaatgtgttctactggctcgtgatcttccttgtgtttcttaacaccctc
acaattgcctctgaacattataaccagtcagattggctcactgaagtccaagacactgcc
aataaggtactgttggctcttttcacggctgagatgctcctgaagatgtacagcctgggt
cttcaagcctactttgtctctctcttcaaccgctttgactgttttattgtgtgtggtgga
atcctagagaccatcttggtggaaacaaagatcatgtcaccactgggtatctcagtgctg
agatgtgtgcgactgctaagaatttttaaaatcacaaggtattggaactctttgagtaat
ttggtggcttccctgctcaactctgtgcgctccatcgcctccctgctgctacttctcttc
ctcttcatcatcatcttctccctcctagggatgcagctctttgggggcaagtttaacttt
gatgagatgcaaaccaggagaagcacatttgacaactttccccagtcgctgctcactgtg
tttcagatcctgactggggaggactggaattcggtgatgtatgatgggatcatggcttat
ggcggcccctcttttccaggaatgttggtctgtatttacttcataatcctcttcatctgt
ggaaactacatcttgctgaatgtctttttggccattgctgtggacaaccttgctgatgct
gagagcctgacatctgctcaaaaagaggaagaagaggaaaaagaaaggaaaaaactagct
agaactgctagtcctgaaaagaaacaggagcctgagaagccagctgtggagggggagaca
aaggaggagaaaattgaactgaaatcgatcactgccgatggagaatctccaccttctaat
aagagcaatgtagatgaatatcagcctaatgaaaatgaagaaaagaatccttatcctact
acagagacgccaggagaagaggaggaggaagagcctgagatgcctgttgggcctcgtcca
cgcccaatgtccgaattgcacctcaaggagaaagctgtgccaatgccagaagccagtgct
tttttcatcttcagccccagcaacaggtttcgggtccactgccaccgcattgttaatgat
aacgttttcaccaacttgatcctctttttcatcttactcagcagcatctctctggcagct
gaggaccctgtccgacatacctccgttcggaatcaaattctcttttattttgatatattt
tttactgtcattttcaccattgaaattgctctgaagatcctaggcaatgcagattatgtc
ttcactagtatctttacattagaaattattcttaagatgactgcttatggagctttcctt
cacaaaggctccttctgcaggaactacttcaacatcctggacctgctggtggttagcgtt
tctctcatctcctttgggatccagtctagtgccatcaacgtagtgaagatactacgagtc
ttgcgagttctcagaccactgagggctatcaacagagccaaaggattaaagcatgtggtt
cagtgcgtgtttgtagccatacgtaccatagggaacattgtgattgtcaccacgctgttg
cagttcatgtttgcctgcattggagtccagttgttcaagggcaaactatatagttgcact
gatagctccaagcaaacagaagcagagtgcaggggcaattttatcacctacaaggatgga
gaagtgtctcaaccaattatccaggctcgaagttgggagaacagcaaatttgattttgac
aatgtcctcactgccatgatggccctcttcactgtttcaacatttgaaggctggccagaa
ctgctgtaccgatccattgattcccatatggaagatgtggggcccatttataaccacagg
gtggagatctctattttcttcattatctacatcatcatcatcgctttcttcatgatgaac
atcttcgttggtttcgtcatcgtcacttttcaggagcaaggagagcaggagtacaagaac
tgtgagctggacaagaaccagcgccagtgtgtcgaatatgccctgaaggcccgccccctt
cggagatatatcccaaaaaaccagtaccagtacaaagtgtggtatgtggtgaattccacc
tattttgaatatttgatgttcatcctcatcctgctgaacaccatctgcctggccatgcag
cactatggtcagagttgcatcttcaaagaagcaatgaacatcctcaacatgctcttcact
ggtctcttcaccgtcgagatggttctgaaattaattgccttcaaacccaagcactatttc
tgtgatgcatggaatacatttgacgccttgattgttgtgggtagcattgttgatatagca
atcaccgaggtgaacccagctgaacatacccaatgctcttcctctatgaacgcagaggaa
aactctcgcatctcaatcacctttttccgactcttccgcgtgatgcgtctggtgaagctc
ttgagccgaggcgagggcatccgcacactgctatggaccttcatcaaatccttccaggct
cttccctatgtggctcttttaatagtgatgctgttttttatctatgctgtgatcgggatg
caggtgtttggtaaaattgccctgaatgataccacagacataaaccggaacaacaacttt
cagaccttcccccaggcagtactactgcttttcagatgtgctactggcgaagcttggcag
gaaatcatgctggcatgcctcccagataagaagtgtgaccctgaatccttggaatcaaac
aactctactgaaggtgaacattcctgtgggagcagctttgctatcttttatttcatcagt
ttctacatgctgtgtgccttcctaatcattaacctttttgtagctgttatcatggataat
tttgattacttaacacgggattggtctattctgggtcctcatcatctggatgagtttaaa
cggatctgggctgaatatgatccagaagccaagggacgtatcaaacacctagatgtggtg
acactgctccgtcggatacagcctccactgggttttgggaaactctgtcctcaccgggta
gcttgcaagcgccttgtgtccatgaatatgccactaaatagtgatgggactgtcatgttt
aatgcaactttgtttgcactggtcagaacagcactgaggatcaaaacagaaggtaacttg
gagcaagcaaatgaagagctgcgtgcaataattaaaaagatttggaagcgcaccagcatg
aagctgttggatcaggttgtgcccccagcaggtgatgatgaggtaacagttggaaagttt
tatgctacattcctgattcaagagtatttccgaaaattcaagaaacgcaaagaacagggc
cttgttggcaaaccttcacagaggaatgctctttccctccaggctggtttgcgcacatta
catgatattggaccagaaattcgacgggcaatctctggagacttaacagctgaagaagaa
ttagacaaggccatgaaagaagctgtttctgctgcctctgaagatgatattttcagaaga
gcaggtggcttgtttggaaatcatgtcagttactaccaaagtgatggcagaagttcattc
cctcagacattcaccactcagcgccctttgcacatcaataaatctagcagcaatcaggga
gacactgaatccccatcccatgagaagcttgtggattccactttcactccaagcagctac
tcatcatccggctccaatgctaacatcaacaatgccaacaacactgccttgagtcgcttc
cccagcccaccaagctaccccagcactgtcagtactgtggaaggccatggcacccctcta
tcacccactgcacggatccaagaagttccttggaagcttggctgcagaagaactaggaca
cattactatgaaacactggggcgatcctgttccagagacagtcaggtggctattgtttgt
gaggaggagacttgtcaagaggaagagaaatatgatgagcaactgaatgaagaaattgag
tactgtggtgaaccaaagctggtaccaactgaaatgctctcatgtaaagatgatgaacac
agacagttaactccacctgaaaacaacattagatactctccaaagagtgggttcctgcat
tcctcatcactaagtcgaagagcatcctttcatctggagtgtcttaagagacagaaaaat
cagggtacggaagtcccacagaagacagcagtgcccttgcatgtggtacatcatcaggca
ctagcagttgcaggcctgagtcctcttcttcaaagaagccattcacccctaagatcatct
cggtcatgtgccacaccccctgccacaccctgtatacaagattggttacagcagcctatt
aaaaccttgcggcttgaaggagaggaatccaatgagaaactcaataatagcttcccatca
atacattgcagctccttgtattctgatagccccagctctagcagcactcgaaaagccagg
ccggtctccctcacagttcccagtcagaccagagagtgtggcagacaatttcacggcagc
gctaacagccttgttgaagcggtcttgatttcggaaggcctggtgcagtttgctcaagat
ccaaagttcattgaggtcacaacccaagagctggctgatgcttgtgacttgacgatagaa
gaaatggagaatgctgctgacaacattctcaatggtaacagcaagccaagccccaatggc
aacctcttgccttttgttaactgcagggacccagggcaggactgtatgggagagaaagag
gaaacagcccagaacccagattgtagaaaaagtcaagaggagcctaaggacagcaggatt
tatatcagcagcctgtag

DBGET integrated database retrieval system