KEGG   Podarcis muralis (common wall lizard): 114605957
Entry
114605957         CDS       T06059                                 

Gene name
BID
Definition
(RefSeq) BH3-interacting domain death agonist isoform X1
  KO
K04726  BH3 interacting domain death agonist
Organism
pmua  Podarcis muralis (common wall lizard)
Pathway
pmua04115  p53 signaling pathway
pmua04210  Apoptosis
pmua04217  Necroptosis
pmua05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pmua00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    114605957 (BID)
   04217 Necroptosis
    114605957 (BID)
   04115 p53 signaling pathway
    114605957 (BID)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    114605957 (BID)
SSDB
Motif
Pfam: BID Bcl-2 CRM1_C CelTOS RAC_head EH_Signature DUF4297
Other DBs
NCBI-GeneID: 114605957
NCBI-ProteinID: XP_028603514
LinkDB
Position
10
AA seq 188 aa
MDQGDYNSPFQEAQLTKILLYSFLEKSSDCAFASELCALKNQLVSEQDDDDELQTDGNRF
GQPEDIIYPNSDEEEIFRIIGAQLAEIGDQLAAEIDPSLIQNLVRQFMAENMSKEAITNH
LSQAVKEVVRRMPLEMERERAMLVVAMVLAKKVANTVPSLLQQVFSTTVNYINQNLRDYV
NNLEPEVI
NT seq 567 nt   +upstreamnt  +downstreamnt
atggaccagggtgattataatagcccctttcaggaggcacagctaaccaagattcttctc
tactccttcctggagaagtcttccgactgcgcttttgcttcagagctttgtgctttgaaa
aaccagttggtttcagagcaggacgatgatgacgagcttcagacagatggcaacagattt
gggcaacctgaggacatcatatatccaaattcagatgaagaggaaattttccggattatt
ggagctcagctggctgaaatcggagatcagctggctgccgagattgacccatcgctcata
cagaatcttgtgcggcagtttatggcggagaacatgtccaaagaggcaataaccaatcac
ctgtctcaagcagtgaaggaagttgtgcgaaggatgcctttggaaatggagcgggagaga
gccatgctagtggtagctatggttttagccaaaaaagtagcaaacactgtgccatctctt
ctacaacaagtgttcagcacaaccgtgaactacatcaaccagaacctccgtgattatgtg
aacaacttggaacctgaggtgatataa

DBGET integrated database retrieval system