KEGG   Podarcis muralis (common wall lizard): 114607585
Entry
114607585         CDS       T06059                                 

Gene name
MYD88
Definition
(RefSeq) myeloid differentiation primary response protein MyD88
  KO
K04729  myeloid differentiation primary response protein MyD88
Organism
pmua  Podarcis muralis (common wall lizard)
Pathway
pmua04010  MAPK signaling pathway
pmua04620  Toll-like receptor signaling pathway
pmua04621  NOD-like receptor signaling pathway
pmua05132  Salmonella infection
pmua05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pmua00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114607585 (MYD88)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    114607585 (MYD88)
   04621 NOD-like receptor signaling pathway
    114607585 (MYD88)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    114607585 (MYD88)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    114607585 (MYD88)
SSDB
Motif
Pfam: Death TIR_2 TIR
Other DBs
NCBI-GeneID: 114607585
NCBI-ProteinID: XP_028606744
LinkDB
Position
12
AA seq 301 aa
MAEVAAVGAAGASPSSPSEEDSVPLVALNYSVRRRLGLFLNPRAPVASDWTALAEELGYD
YLEIKHFEGKADPTESLLADWQKRCPGGATVGRLLGLLRHLGRRDVLADLGTSIEEDCKK
YLRRKQQEEAERPVQVPAVDSSIARASELQGITTQDDPLGHTVEMFDAFICYCPNDLHFV
QEMIQELEQTEHKLKLCVFDRDVLPGTCVWSITSELIETRCRKMVVVISDDYLDSEACDF
QTKFALSLSPGARRKCLIPVKCKSMKKEFPSILRFITVCDYTNPCTKKWFWMRLAKSLLV
P
NT seq 906 nt   +upstreamnt  +downstreamnt
atggcggaggtcgctgctgttggcgccgctggcgcgtctccgtcctccccgtcggaagaa
gactcggtgccgctggtggcgctcaactactcggtgcgccgccgcctggggctcttcctc
aacccgcgcgccccggtggcctccgactggacggcgctggccgaggagctgggctacgac
tacctggagatcaagcacttcgaaggcaaggccgaccccaccgagagcctcttggccgac
tggcagaagcgctgccccggcggcgctaccgtgggccgcctcctggggctgctgcgccac
ctcggccgccgggacgtcctggctgacctggggaccagcatcgaagaagattgcaagaag
tacctgcggaggaaacagcaggaggaggcggagaggcccgttcaggtcccggcggtggac
agcagtatcgcaagggcatctgaactgcagggcatcactacgcaagatgacccccttgga
cacacggtagagatgtttgatgccttcatctgttactgcccgaacgaccttcactttgtg
caagagatgatccaagagctggaacagacagagcacaagctgaagctctgtgtgttcgac
cgggatgtcctccccggaacgtgcgtctggtccatcaccagcgagcttatagagacgcgg
tgccggaaaatggtggtagtgatttcggatgactaccttgatagcgaagcctgtgacttc
cagaccaagtttgccctcagcctctccccaggagctcgccgcaagtgcctcattccagtt
aagtgcaaaagcatgaagaaggagttcccaagcatcctcaggttcatcacggtttgcgac
tacaccaacccctgcaccaagaaatggttctggatgcggctggccaagtccctgttggtc
ccatga

DBGET integrated database retrieval system