KEGG   Petrimonas mucosa: ING2E5A_0039Help
Entry
ING2E5A_0039      CDS       T04553                                 

Gene name
sodB
Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
pmuc  Petrimonas mucosa
Brite
Enzymes [BR:pmuc01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     ING2E5A_0039 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: SCM55125
UniProt: A0A1G4G301
LinkDB All DBs
Position
I:complement(42341..42916)
Genome map
AA seq 191 aa AA seqDB search
MKFEKVALPYATDALEPVISKTTVELHYGKHHQAYVDNLNKLVVGTEFENADLETVVKKS
SGAIFNNAGQILNHNLYFTSFKPNGGGEPKGKLAEAINAQFGSFDKFKEEFNAAGVSVFG
SGWVWLAKDANGKLSIEKESNAGNPLTKGLTPILGFDVWEHSYYLDYQNRRADHLKELWK
IIDWDVVSNRY
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttgaaaaagtagcattaccttatgcaaccgatgccttagagccggtaatcagc
aaaacaaccgttgagctccattatggcaagcaccatcaggcttatgtcgacaacctcaac
aagctggttgttggaaccgagtttgaaaatgcagacctggaaaccgtcgtgaagaagagc
agcggagccatcttcaacaatgccggacagatcctcaatcacaacctctacttcacctcc
ttcaagcccaatggcggtggagaacccaaggggaagctggcagaggccatcaacgcccag
tttggttcgttcgacaagttcaaggaggagttcaatgctgccggtgtctccgttttcggt
tcgggatgggtctggttggccaaggatgccaacggcaaactctcgatcgagaaggagtcg
aatgcaggaaacccgttgaccaaaggtctgacgccgatcctgggatttgatgtatgggaa
cactcttactatctcgactaccagaaccgccgtgcggatcacctgaaggagctctggaag
atcatcgactgggatgtggtgagcaaccgctattga

DBGET integrated database retrieval system