KEGG   Petrimonas mucosa: ING2E5A_0881
Entry
ING2E5A_0881      CDS       T04553                                 

Gene name
xdhA
Definition
(GenBank) putative D-xylulose reductase A
Organism
pmuc  Petrimonas mucosa
SSDB
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 TrkA_N 2-Hacid_dh_C Shikimate_DH AlaDh_PNT_C
Other DBs
NCBI-ProteinID: SCM56441
UniProt: A0A1G4G5E6
LinkDB
Position
I:complement(1066979..1068010)
AA seq 343 aa
MKALVLDNYMELNYRDVPDPQLEVDEVLIRVKACGICGSDVHGMDGSSGRRIPPLVMGHE
AAGVISAIGAAVTGWEVGDRVTFDSTIYPLDDWYTRKGHYNLSDNRKVLGVSTGHYRKEG
AFAEFVAVPAHILYRIPDNVTFEQAAMTEPVAVALHAVNISGIRPGESAVVIGTGTIGLF
VVKLLQIAGAFPIIAVERDEEKLKLAKSFGATDLLLSSDSLVTGTIEALTNNRKADVAFE
AVGIQETVNLCIKSLRKGGRAILIGNLMPEVTIPLQQVVTSELSLLGSCAINGEYETVLE
LMRSGKIEVDGMISAVAPLSEGAEWFRRLYNKESGLRKVILVP
NT seq 1032 nt   +upstreamnt  +downstreamnt
atgaaagcactggtactggataactacatggagctgaactatcgcgacgtccccgatccg
cagttggaagtcgacgaagtgttgatcagggtcaaagcgtgcggaatatgcggaagtgac
gtacacggcatggacggaagcagtggcagaagaatacccccattggtgatgggacatgaa
gccgcaggagtaatctccgccatcggggcggcagtaacgggttgggaagtgggcgacagg
gtcactttcgactccacgatctatccgctcgacgactggtacacccgcaagggacattac
aacctcagcgacaacagaaaagttctgggtgtctccactgggcactaccggaaagagggc
gcatttgccgagtttgtagctgttccggcccatatcctatacaggatccccgacaatgtc
accttcgaacaggccgccatgacggagcccgtggcagtggcactccatgccgtcaatatt
tccggcatacgtccgggagagtctgcagtggtgatcggcacggggacgatcgggctcttt
gtagtcaagttgctgcagatagccggtgcatttcccatcattgccgtggagagggatgaa
gagaaactgaaactagccaagagcttcggcgcaacggatcttctcctcagttccgacagt
ctggttaccggcacgattgaagcacttaccaacaaccggaaggcggatgtcgcttttgag
gctgtggggatccaggaaacggtaaacctctgcataaagagtctgcgaaaaggaggcaga
gctatcctgatcggcaacctgatgccagaagtgaccattccgctccagcaagtggtgact
tctgagctttctcttctggggagttgtgccatcaacggcgaatatgaaactgtacttgaa
ctgatgcgctccggcaagatcgaagttgacgggatgatatctgccgtggctccactatcc
gaaggagctgaatggttcagacgactctacaacaaggagagcggcttgcgtaaagtgata
ctggttccctaa

DBGET integrated database retrieval system