KEGG   Petrimonas mucosa: ING2E5A_1491Help
Entry
ING2E5A_1491      CDS       T04553                                 

Gene name
pdhC3
Definition
(GenBank) Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pmuc  Petrimonas mucosa
Pathway
pmuc00010  Glycolysis / Gluconeogenesis
pmuc00020  Citrate cycle (TCA cycle)
pmuc00620  Pyruvate metabolism
pmuc01100  Metabolic pathways
pmuc01110  Biosynthesis of secondary metabolites
pmuc01120  Microbial metabolism in diverse environments
pmuc01130  Biosynthesis of antibiotics
pmuc01200  Carbon metabolism
Module
pmuc_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pmuc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ING2E5A_1491 (pdhC3)
   00020 Citrate cycle (TCA cycle)
    ING2E5A_1491 (pdhC3)
   00620 Pyruvate metabolism
    ING2E5A_1491 (pdhC3)
Enzymes [BR:pmuc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     ING2E5A_1491 (pdhC3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding AATase
Motif
Other DBs
NCBI-ProteinID: SCM57750
UniProt: A0A1G4G708
LinkDB All DBs
Position
I:1790940..1792049
Genome map
AA seq 369 aa AA seqDB search
MEERQLVRATPAARLLARRMNVLLTNVTGTGYKGRIHKEDVAGWNFQGKTHVSPLARRIA
EEHNIDLKGVRGTGHNGKIMKDDVLLLISDPVLKARLTRDSFAEATAAPKIQTGISKQLQ
IVQTEPKPGQPARVEEATASETVPLTMMRKVIAKRMSESYFSIPSFIQTWEIDMTELLDL
RKRLLEPIKEKTGKKLTVTDLISFAVVKTLMKHKYINASLNSEVTEITFHNYVNLGMAVG
MDEGLLVPVVKNADKMSLSELVVSLKDLTERTLNKKLLPDEQTGSTFTISNLGMYGVEHF
TAIINQPNAAILSVSSTKETLVVRNGEAVIRPIMKVSLTSDHRIIDGLTAAKFMTDLKQL
LENPLSLLI
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaagacaattagtaagggcaacccctgcggcgagattgctggccagacggatg
aatgtgttgctgacgaatgtgaccgggacaggttacaagggacggattcataaagaggat
gttgccggatggaatttccagggcaagactcatgtttcgccgcttgcacgtagaattgcc
gaggaacacaacatcgacctgaagggtgtcaggggcaccggacacaacggtaaaatcatg
aaggatgatgtgctgttactgatctccgatcccgtactgaaagcacggcttacgcgtgat
tcttttgccgaggctacggcagcgccgaaaatccagactggaatcagcaagcagctacag
atagtacagaccgaaccgaagcctggtcagccggccagggttgaagaggccacagcctcg
gagaccgttcccttgaccatgatgcgtaaagtgatagccaagcggatgtcggaaagctat
ttctcgatcccttcgtttatccagacttgggaaatcgatatgaccgaactgcttgatctg
cgcaaacggctattggaaccgataaaggagaaaaccggcaagaaactgaccgtcaccgat
ctgatctcgtttgccgtggtgaagacactgatgaagcacaagtatatcaatgcgagtttg
aatagcgaggttacggaaatcactttccacaactacgtgaacctgggaatggccgtaggg
atggatgagggattgctggtaccggtagtgaagaatgccgacaaaatgtcgctcagtgaa
ctggtcgtctcgctgaaggatctcaccgaacggactctcaacaagaaactgttgcccgac
gagcagaccggcagcacctttaccatcagtaatctgggcatgtatggtgtggagcatttc
acggcgatcatcaatcagcccaatgctgctatcttgagtgtttcatctacaaaggagacg
ctagtggtacgtaacggggaagcggtaatccgcccgataatgaaggtaagcctcacaagc
gatcaccggatcatcgacggactgacggcagccaaattcatgaccgatctgaagcaattg
cttgagaatccgctctcactattaatataa

DBGET integrated database retrieval system