KEGG   Petrimonas mucosa: ING2E5A_2433Help
Entry
ING2E5A_2433      CDS       T04553                                 

Gene name
tuf
Definition
(GenBank) Elongation factor Tu {ECO:0000255|HAMAP-Rule:MF_00118}
  KO
K02358  elongation factor Tu
Organism
pmuc  Petrimonas mucosa
Brite
Translation factors [BR:pmuc03012]
 Eukaryotic Type
  Elongation factors
   ING2E5A_2433 (tuf)
 Prokaryotic Type
   ING2E5A_2433 (tuf)
Mitochondrial biogenesis [BR:pmuc03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    ING2E5A_2433 (tuf)
Exosome [BR:pmuc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   ING2E5A_2433 (tuf)
  Exosomal proteins of breast cancer cells
   ING2E5A_2433 (tuf)
  Exosomal proteins of colorectal cancer cells
   ING2E5A_2433 (tuf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW Gtr1_RagA CbiA
Motif
Other DBs
NCBI-ProteinID: SCM59231
UniProt: A0A1G4G9Q4
LinkDB All DBs
Position
I:2933457..2934644
Genome map
AA seq 395 aa AA seqDB search
MAKEHFQRTKPHVNIGTIGHVDHGKTTLTAAITTVLAKRGFSEVRSFDSIDNAPEEKERG
ITINTSHVEYQTANRHYAHVDCPGHADYVKNMVTGAAQMDGAIIVVAATDGPMPQTREHI
LLARQVNVPKLVVFMNKVDLVDDEEMLDLVEMEMRELLSFYNFDGDNTPIIRGSALGGLN
GEPKWEEKIMELMDAVDEWIPLPPRDIDKPFLMPIEDIFSITGRGTVATGRIETGVIKTG
EEVQIIGLGAEGKKSVVTGVEMFRKILDRGEAGDNVGLLLRGIDKDEIKRGMVISHPGKV
QPHSKFKAEVYILKKEEGGRHTPFHNKYRPQFYIRTLDVTGEIQLPEGVEMVMPGDNVTI
EVDLIYPVACNVGLRFAIREGGRTVGAGQITELLD
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagaacattttcagcggacgaagccgcatgttaacatcggtacgataggtcac
gttgaccacggtaaaaccaccttaacggctgcgattaccaccgttttggcaaaaagaggt
ttctctgaagtacgttcgttcgattctatcgacaacgctccggaagaaaaagaaagaggt
atcactatcaacacttcacacgttgaataccaaacagcaaatcgtcactacgcacacgtt
gactgcccgggccacgctgactatgtgaagaacatggtaaccggagctgcccagatggac
ggtgccatcatcgttgttgccgcaactgacggtcctatgcctcaaactcgcgaacacatc
ctgctggcacgtcaggtaaacgttccgaagctggttgttttcatgaacaaggtcgacctg
gttgacgacgaagagatgcttgacctggtagagatggaaatgcgtgaactgctttcattc
tataacttcgacggagacaacactcctattatccgtggatctgcccttggtggtctgaat
ggcgaaccgaaatgggaagaaaagatcatggagctgatggatgcagttgacgagtggatt
ccgctgcctccgcgcgatatcgacaaaccgttcctcatgccgatcgaagacatattctcg
atcaccggtcgtggaaccgttgccactggccgtatcgaaaccggtgttatcaaaaccggt
gaagaggttcagatcatcggtctgggtgctgaaggcaagaaatctgtggttaccggagtt
gaaatgttccgcaagatcctcgacaggggtgaagccggcgataacgtaggtttgctgctc
cgtggtatcgacaaggatgagatcaaacgtggtatggttatctctcaccccggaaaagtt
caacctcactccaaattcaaggcagaggtttatatcctgaagaaagaagaaggcggtcgt
cacacaccgttccataacaaatatcgtcctcagttctacatccgcaccctggacgtaacc
ggagagatccagttgccggaaggagtagaaatggttatgcctggtgacaacgttaccatc
gaagtagatctgatctaccccgttgcttgtaacgtaggtcttcgcttcgcaatccgcgaa
ggtggacgcaccgtaggtgcaggccagatcactgagctgctcgattaa

DBGET integrated database retrieval system