KEGG   Petrimonas mucosa: ING2E5A_2446Help
Entry
ING2E5A_2446      CDS       T04553                                 

Gene name
tdk
Definition
(GenBank) Thymidine kinase {ECO:0000255|HAMAP-Rule:MF_00124}
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
pmuc  Petrimonas mucosa
Pathway
pmuc00240  Pyrimidine metabolism
pmuc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmuc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    ING2E5A_2446 (tdk)
Enzymes [BR:pmuc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     ING2E5A_2446 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK
Motif
Other DBs
NCBI-ProteinID: SCM59243
UniProt: A0A1G4G9M0
LinkDB All DBs
Position
I:complement(2950829..2951401)
Genome map
AA seq 190 aa AA seqDB search
MYNNPKETHCKGRIEVICGSMFSGKTEELLRRLRRAKIARQEVEIFKPAIDVRYSQEEVV
SHDRNSIPSTPVEHSSNILLLSSEVEVVGIDEAQFFDNGLAEVCQQLADQGIRVIVAGLD
MDFKRVPFGPMPALCAIADDVTKVHAICVRCGSLASYSHRIVEGEKQVMLGEMQEYQPLC
RNCYLHEKGR
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgtacaacaatccaaaggaaactcactgcaagggacgtatcgaggttatctgcggttcc
atgttctccggaaagaccgaggagttgctgcgacggttgcgtcgtgcaaaaattgcccgt
caggaggtagagatattcaaaccagccatagatgtccgctattcacaggaggaggtggtg
tcgcacgacaggaactccatcccttcaacacccgtggagcactccagcaatatcctgctg
ctctcttccgaagttgaagtggtgggtattgacgaagctcaattttttgacaatggactg
gccgaggtttgtcagcaattggccgatcagggcatccgtgttattgtggccggtctcgat
atggattttaaaagggtccccttcgggccgatgcctgccttgtgtgccattgccgatgat
gtgaccaaggtgcatgccatctgtgtcagatgcggttcactggccagctattcacaccgc
atagtggagggggagaagcaggtgatgttgggagaaatgcaggagtaccagccgctttgc
aggaattgctatttgcatgaaaaggggaggtga

DBGET integrated database retrieval system