KEGG   Petrimonas mucosa: ING2E5A_2630Help
Entry
ING2E5A_2630      CDS       T04553                                 

Gene name
murF_3
Definition
(GenBank) UDP-N-acetylmuramoyl-tripeptide-D-alanyl-D-alanine ligase {ECO:0000255|HAMAP-Rule:MF_02019}
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
pmuc  Petrimonas mucosa
Pathway
pmuc00473  D-Alanine metabolism
pmuc01100  Metabolic pathways
pmuc01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pmuc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    ING2E5A_2630 (murF_3)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    ING2E5A_2630 (murF_3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pmuc01011]
    ING2E5A_2630 (murF_3)
Enzymes [BR:pmuc01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     ING2E5A_2630 (murF_3)
Peptidoglycan biosynthesis and degradation proteins [BR:pmuc01011]
 Precursor biosynthesis
  Racemase
   ING2E5A_2630 (murF_3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Mur_ligase_M Herpes_V23 Mur_ligase
Motif
Other DBs
NCBI-ProteinID: SCM59426
UniProt: A0A1G4GA49
LinkDB All DBs
Position
I:3179964..3182432
Genome map
AA seq 822 aa AA seqDB search
MKYSIQKIASILGIKNQYLLEGEITQLLTDSRKLNYPQETLFFAIETRQNDAHKFIADLY
GSGVRNFVVTKILPEWKSFTDANFLKVGNTLHALQRVAAYHRKQFDIPVIGITGSNGKTV
VKEWLYQLLEEDYNIVRSPRSYNSQTGVPLSVWELNQNATLAIFEAGISQPDEMKYLEQV
IRPTIGVFTKLGEAHQENFSSQQQKCMEKLELFTNSNVVIFEEDNKIINQSADMMVLLQK
AFCWSRKYPDAPLYIRKTEKNGERTTIHYSFLNFDYSVTIPFTDDASVENAISCLAVMLY
LNVKPEKISERMMKLEPVAMRLDVRQGKNNCIIINDTYNSDINSIKIALDFQQQRKLERT
MKKTLIISDILQTGLLPKSLYKYVAELVQHGRIEKLIGIGHDICENSEVFTVGEKFFFRS
TEDFIRSEIWKSFENELILLKGSRKYHFEQINELLEQRVHETVLEVDLDALVHNFNFYKS
RISPNTKLICMVKANGYGAGAVEIAKTLQYHRCPYFAVAVAEEGIELRKEGISTPIIVLN
PEVNGFEELFSKDLEPEVYNFRILDAFIREAERRGITNYPIHVKIDTGMHRLGFLPAQIP
ELIGRLKSQKGLKVKSLFSHLAASESWMFDSFTQEQIATLEAAHREICSQLGYPVWKHIL
NSAGIERFIDAQWDMVRLGIGLYGVSASGLSGLRNVVTLKTTILQIQEIPNHETVGYGRK
ETLNRDTRIATIRIGYADGLDRKCGNRNGKVWINGKYAPIVGNVCMDLCMIDITGIDAKE
GDTVVVFGENLPVLEVAESINTIPYEILTSISPRVKRVYVKE
NT seq 2469 nt NT seq  +upstreamnt  +downstreamnt
atgaagtactcaatccaaaaaatagcctcgatactgggcataaagaaccaatatctttta
gagggcgaaataacacaactgcttacagacagccggaagttgaattatccccaggagaca
ctcttcttcgccatcgagacaaggcagaacgatgcacacaagtttattgccgacctttat
ggctctggcgtcaggaatttcgtagtgaccaaaattctaccggagtggaaatctttcacc
gatgccaattttctcaaagttggcaacacactccacgccctgcagagagtggccgcatat
caccgtaaacagttcgatattccggtgatagggattaccggaagcaatgggaaaacggtt
gtcaaggagtggctctatcagcttctggaggaggattacaatattgtccgctcacctcgt
agctacaactcccaaaccggcgttccgctgtcggtctgggaactgaatcagaatgccacc
ctggccatattcgaagccggcatctcccaacccgacgaaatgaaatatctcgaacaggtt
atccgacccacaatcggtgtatttacaaagttgggcgaagctcaccaggagaacttttcg
tctcaacagcagaaatgtatggaaaagctggagcttttcaccaatagcaacgtggtcatc
tttgaggaggacaacaagatcatcaaccaatcggccgacatgatggtcttgttgcaaaaa
gcattctgctggtcgcggaaatatccagatgccccactctacatccgtaagacggagaag
aacggtgagaggactaccatccattactcctttctcaatttcgactactcggtcacgatc
ccatttaccgacgacgcctctgttgagaatgccatcagctgcctcgcggtaatgctctac
ctgaacgtcaagccggagaagatttcagaacggatgatgaaactggagccggtagccatg
cgtctcgatgtccgtcagggaaagaacaactgtatcatcatcaacgacacctacaactcc
gacatcaactccataaagattgcgctcgatttccagcagcagcggaaactggaaagaaca
atgaagaagacattgatcatttcagacatacttcagacagggctgttgccgaaatcactc
tataaatatgtggccgaactggtacagcacggccgtatcgagaaactgatcgggatcggt
catgatatttgcgagaacagtgaggtatttactgtcggggagaaattcttctttcggtcg
accgaagatttcatccgttccgagatctggaaaagtttcgaaaacgagctgatactgctg
aaaggttcacgcaagtaccatttcgagcagataaacgagctccttgaacaacgtgttcac
gaaaccgttctggaggtcgatctggatgcacttgtccacaacttcaacttctataaatcg
aggatatcgcccaacacgaaactgatctgcatggtgaaagccaatggttatggagcaggg
gctgtggagatagccaaaacgttgcagtatcacagatgtccctatttcgcggttgcagtt
gccgaagagggtatcgagctgcgcaaggaggggatatcaactccgataatcgtgctgaac
cccgaagtcaacggattcgaggagctcttctcgaaagacctggaaccggaggtatacaac
ttcaggattctcgacgcctttatcagggaggccgaaaggcgtggcataaccaactacccc
atccacgtgaagatcgataccggcatgcatcggttggggttcctccccgcgcagattcct
gaactgatcggacggttaaaatcccagaagggtttgaaggtgaagtctcttttctcacac
ctggctgccagtgaaagctggatgttcgacagtttcacacaggagcagatcgccactctc
gaagccgcacaccgggagatctgcagtcaactgggctatccggtctggaaacatatcctc
aattcagccggcatcgagaggtttatcgacgcccagtgggatatggtaaggctgggaatt
gggctatacggggtaagtgcaagtggcctgagcggcttaaggaacgttgtcacactcaaa
accaccatcctgcagatccaggagattcccaaccacgaaactgtcggctacgggaggaaa
gagaccctcaaccgcgacaccagaattgccacgatacgcatcggttatgccgacggactg
gacaggaagtgcgggaacagaaacgggaaagtgtggatcaacggcaaatatgccccaatc
gtgggaaatgtatgtatggatctctgcatgatcgacattaccggcatcgatgccaaggaa
ggcgatacggtggtggtcttcggtgaaaacctgcccgtattggaggttgccgaaagcata
aataccatcccttacgagattctcacttcgatctctccccgtgtgaaacgtgtatatgta
aaagagtaa

DBGET integrated database retrieval system