KEGG   Pasteurella multocida ATCC 43137: DR93_1884Help
Entry
DR93_1884         CDS       T03322                                 

Gene name
fabI
Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase [NADH]
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
pmul  Pasteurella multocida ATCC 43137
Pathway
pmul00061  Fatty acid biosynthesis
pmul00780  Biotin metabolism
pmul01100  Metabolic pathways
pmul01130  Biosynthesis of antibiotics
pmul01212  Fatty acid metabolism
Module
pmul_M00083  Fatty acid biosynthesis, elongation
pmul_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:pmul00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    DR93_1884 (fabI)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    DR93_1884 (fabI)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    DR93_1884 (fabI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:pmul01004]
    DR93_1884 (fabI)
Enzymes [BR:pmul01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     DR93_1884 (fabI)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     DR93_1884 (fabI)
Lipid biosynthesis proteins [BR:pmul01004]
 Fatty acid synthase
  Component type
   DR93_1884 (fabI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Fe_hyd_lg_C Enoyl_reductase
Motif
Other DBs
NCBI-ProteinID: AIN49708
UniProt: A0A126QDL7
LinkDB All DBs
Position
1978976..1979758
Genome map
AA seq 260 aa AA seqDB search
MGFLTNKRILIAGVASNRSIAYGIAQAMKREGAELAFTYQNDKLKGRVEEFAKELGSDIV
IPCDVGTDESIEQCFAELAKHWEKFDGFVHSIAFAPGDQLDGDYVDAVNREGFRIAHDVS
SYSFVAMAKAARGMLNPNSALLTLSYLGAERAIPNYNVMGLAKASLEANTRFMAAALGKD
GIRVNAISAGPIRTLAASGIKNFKKMLANFEQTAPLRRTVTIEDVGNSAAFLCSDLSAGI
TGEVVHVDAGFSIVAMGELE
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgggtttcttaacaaacaaacgtattttaattgccggtgtggcaagtaatcgttctatt
gcttacggtatcgcacaagcaatgaaacgtgaaggggcagaactcgctttcacgtatcaa
aatgataaattaaaagggcgtgtagaagaatttgctaaagaattaggttctgatattgtg
attccttgtgatgtgggcacggatgaaagtatcgaacaatgctttgctgaattagctaaa
cactgggaaaaatttgatggttttgttcattctatcgcttttgcgccgggcgaccaatta
gacggtgattatgtggatgcagtaaaccgcgaaggtttccgtattgcacacgatgtgagt
tcatatagctttgttgcgatggcaaaagccgcgcgtggcatgttgaatccgaactcagcc
cttttaacactttcctacttaggggcagaacgtgcaattcctaactataacgtgatgggc
ctagccaaagcctcattagaagctaatacgcgttttatggcagcagcattaggtaaagac
ggtatccgcgtaaatgcaatctctgcaggaccaattcgtacacttgccgcctctggtatt
aaaaacttcaagaaaatgctcgcaaacttcgaacaaaccgcaccattacgccgtactgtg
acgattgaagatgtcggtaactctgcagctttcttatgctcagatttaagtgccggtatc
acaggtgaagtggtccatgttgatgccggtttcagcatcgtagctatgggtgaactcgaa
taa

DBGET integrated database retrieval system