KEGG   Prunus mume (Japanese apricot): 103321739Help
Entry
103321739         CDS       T03196                                 

Definition
(RefSeq) aldehyde dehydrogenase family 2 member B7, mitochondrial
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
pmum  Prunus mume (Japanese apricot)
Pathway
pmum00010  Glycolysis / Gluconeogenesis
pmum00053  Ascorbate and aldarate metabolism
pmum00071  Fatty acid degradation
pmum00280  Valine, leucine and isoleucine degradation
pmum00310  Lysine degradation
pmum00330  Arginine and proline metabolism
pmum00340  Histidine metabolism
pmum00380  Tryptophan metabolism
pmum00410  beta-Alanine metabolism
pmum00561  Glycerolipid metabolism
pmum00620  Pyruvate metabolism
pmum00903  Limonene and pinene degradation
pmum01100  Metabolic pathways
pmum01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pmum00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103321739
   00053 Ascorbate and aldarate metabolism
    103321739
   00620 Pyruvate metabolism
    103321739
  09103 Lipid metabolism
   00071 Fatty acid degradation
    103321739
   00561 Glycerolipid metabolism
    103321739
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    103321739
   00310 Lysine degradation
    103321739
   00330 Arginine and proline metabolism
    103321739
   00340 Histidine metabolism
    103321739
   00380 Tryptophan metabolism
    103321739
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    103321739
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    103321739
Enzymes [BR:pmum01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     103321739
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh AAA_25
Motif
Other DBs
NCBI-GeneID: 103321739
NCBI-ProteinID: XP_008221788
LinkDB All DBs
Position
LG2
AA seq 534 aa AA seqDB search
MASRRVSSVLSRSFTSASLFSAGRSSSVARGIGKYSTDASFEAPIIPSVKVNYTQLLING
QFVDAASGKTFPTLDPRTGNVIAHVAEGDSEDINRAVSAARKAFDEGPWPKMTAYERSRV
LFRFADLVEKHNDEIATLETWDNGKPFEQAAKTEVPMIVRFFRYYAGFADKIHGLTVPAD
GEYHVQTLHEPIGVAGQIIPWNFPLLMFAWKVAPALACGNTVVLKTAEQTPLSALYVATL
LQEAGLPPGVLNVVSGFGPTAGAALCSHMEVDKVAFTGSTDTGKKVLELAAKSNLKTVTL
ELGGKSPFIVCEDADVDKAVELAHFALFFNMGQCCCSGSRTFVHERVYDEFIEKAKARAE
KRIVGDPFKGGVEQGPQIDSDQFEKILRYIDYGIKSGATLETGGGRLGTKGFYIKPTVFS
NVKDDMPIAQDEIFGPVQSILKYKDLDEVIRRANTTRYGLAAGVFTQNIDTANTLTRALR
VGSVWINCFDVFDAAIPFGGYKMSGHGREKGIYGLSNYLQVKAVVTPLKNPAWL
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atggcgtctcggagggtctcttcggttctgtctcgttcattcacttctgcttctctgttt
tctgcagggaggtcttcttctgtggctagaggaattggtaaatatagcactgatgcttca
tttgaggcaccaatcattccatccgttaaagtaaattatactcagcttctaattaatgga
caatttgtagatgcagcatcagggaaaacttttcccacattggacccccgaactgggaat
gtgattgctcatgttgctgaaggtgattctgaagatataaatcgggcagtttctgctgcc
cgcaaggcctttgatgaaggaccatggccaaagatgacagcttatgaaagatcaagggtc
cttttccgctttgctgatttggttgaaaagcataatgatgaaattgcaacccttgagact
tgggataatgggaagccatttgaacaggctgctaaaactgaagtaccaatgattgtgcgt
tttttccggtactatgctggatttgcggataagattcatggtctcacagttccagctgat
ggagagtatcatgtgcaaaccttgcatgaacctataggtgttgcaggtcagataattcca
tggaatttccctcttctcatgtttgcttggaaggttgcgcctgccttagcatgtggcaac
accgttgttctgaagacagcagagcagacaccattgtctgctctatatgtagcaacgctg
ttgcaggaggctggacttcctccaggtgttttaaatgtggtttcaggttttggtccaaca
gccggtgcagcgctttgtagtcatatggaagttgataaggttgcttttactggatcaact
gataccggaaaaaaagtactagagttggctgccaaaagcaatcttaagactgtaactttg
gagcttggcgggaaatccccatttattgtatgtgaggatgctgatgtagataaggctgtt
gagctggcacactttgctctattctttaatatgggtcaatgctgctgttctggttctcgt
acatttgtacatgaaagagtatatgatgagttcatagagaaagcaaaggcccgtgctgag
aaacgcattgttggtgatccattcaagggtggtgttgagcaaggtcctcagattgattca
gaccaatttgagaagatcctgaggtacattgattatggtattaaaagtggagctacactg
gaaactggaggagggaggcttggcacaaagggtttctatattaagcccactgtattctca
aatgttaaggatgacatgccaatagcacaggatgagatttttggtcctgtgcagtccatc
ttgaaatacaaggaccttgatgaggtgataagaagggcaaatactacgcgatacgggctt
gctgcaggggtcttcacacaaaacatagatactgcaaacacattgacacgcgcattgcgg
gtcggtagtgtatggataaactgctttgatgtctttgatgctgcaattccttttggaggg
tacaagatgagtggacatggaagagaaaagggcatttacggtctttctaattacttgcaa
gttaaggctgttgtcacgcccctgaaaaatcctgcatggctataa

DBGET integrated database retrieval system