KEGG   Prunus mume (Japanese apricot): 103322691Help
Entry
103322691         CDS       T03196                                 

Definition
(RefSeq) UDP-galactose/UDP-glucose transporter 5B
  KO
K15276  solute carrier family 35 (adenosine 3'-phospho 5'-phosphosulfate transporter), member B2
Organism
pmum  Prunus mume (Japanese apricot)
Brite
Transporters [BR:pmum02000]
 Solute carrier family (SLC)
  SLC35: Nucleoside-sugar transporter
   103322691
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UAA EamA TPT
Motif
Other DBs
NCBI-GeneID: 103322691
NCBI-ProteinID: XP_008222845
LinkDB All DBs
Position
LG1
AA seq 348 aa AA seqDB search
MAETAPLSIVTQPSKLWKGVFAVAGIMTTLVTYGVLQEKIMRVPYGDDKAFFRYSLFLVF
CNRIATSAISAAALLASKKALDPVAPVYKYSLVSVSNILTTTCQYEALKYVSFPVQTLAK
CAKMIPVMVWGTIIMQKKYKGQDYLLAFLVTVGCSIFILYPAGSSEIGPSDIYGRGRENT
VWGISLMIGYLGFDGFTSTFQDKLFKGYDMEIHNQIFYTAFCSCVISLTGLILQGQLLPA
IHFVSIHNDCFFDIAMLSTVATASQFFISYTIRTFGALTFATIMTTRQLVSIMLSCLWFS
HPLSREQWIGAVVVFGTLYAKSFLRSAPKPSPSQQMQNGASLPVKGNP
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atggccgaaacggcgccgttatcgattgttacgcagccgagcaagctatggaagggggtt
ttcgccgtggccggaatcatgaccacgctcgtcacctacggcgttctccaggaaaagatc
atgagagtcccgtacggggacgacaaggcgtttttcaggtactcgttatttctcgtcttc
tgcaatcgcattgcgacgtcggcgatctccgccgcagccttgttggcgagcaagaaggct
ttggatcccgttgctccggtctacaagtactcccttgtatcggtttctaacatattaacc
actacatgtcagtatgaggctctcaaatacgtcagctttcctgttcaaacacttgcaaaa
tgtgccaagatgatacctgtgatggtttggggcactatcattatgcaaaagaaatacaag
ggacaggactatttgttggcatttctagtgacagtgggctgttcaatatttattttatat
ccggcaggatcttctgagattggtccatctgatatatatggtagaggaagagaaaatact
gtttggggcatttccctaatgattggttatcttgggtttgatggctttacaagcacgttc
caagataaactatttaaaggctatgatatggagatacacaatcaaatattttacactgca
ttctgttcttgtgttatcagcttgacaggtcttatattacaaggacagttgcttccagca
atccactttgtttctatccacaatgattgtttctttgacattgcaatgctttccactgta
gcaacagctagccaatttttcatttcttacacgattcgcacatttggtgctctcacattt
gccactataatgaccacaagacagttggtcagcattatgctatcatgcttgtggttttca
cacccccttagcagggaacaatggattggagctgtcgttgtctttggtaccctctatgca
aaaagcttcctgagaagtgcaccaaagccttcaccttcccaacaaatgcagaatggagct
tctcttccagtgaaggggaacccttga

DBGET integrated database retrieval system