KEGG   Prunus mume (Japanese apricot): 103325388Help
Entry
103325388         CDS       T03196                                 

Definition
(RefSeq) alpha-glucosidase-like
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
pmum  Prunus mume (Japanese apricot)
Pathway
pmum00052  Galactose metabolism
pmum00500  Starch and sucrose metabolism
pmum01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmum00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    103325388
   00500 Starch and sucrose metabolism
    103325388
Enzymes [BR:pmum01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     103325388
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 103325388
NCBI-ProteinID: XP_008225765
LinkDB All DBs
Position
LG3
AA seq 910 aa AA seqDB search
MKMQRSRPNKPKPIYHLPLFFFFFFFFLSAVFHCGLASSSNTKGAKEAAVAGFGYKIQSV
NYDSSGNSLTANLGLIKKSSVYGPDIPNLNLHASYETKDRLRIRITDSKHQRWEIPQQII
PRQTTSQHPQQCQTRNKHLVISNDLVFTLHNTTPFGFTVTRQSSKDVIFDSSPNPSNPDT
FLVFKDQYIQLSSSLPKARSSLFGLGEHTKSSFKLTPNQTLTLWTADIASANADVNLYGS
HPFYLDVRSASPDGKADSAGTSHGVLLLNSNGMDITYGGDRITYKAIGGIVDLYFFSGPT
PELVVEQYTELIGRPTPMPYWSFGFHQCRYGYKNVSDLGGVVAGYAKAAIPLEVMWTDID
YMDAYKDFTLDPINFPLDKMKKFVNTLHQNDQKYVLILDPGISVNKSYGTYNRGLKADIF
IKRDGIPYLGSVWPGPVYFPDFAHPQSENFWANEIKIFQDALPFDGLWLDMNELSNFITS
PPTPSSTLDDPPYKINNAGVLRPINNNTVPASALHFGNITEYDAHNLYGLLESKATNKAL
VDVTGKRPFILSRSTFVSSGRYTAHWTGDNAAKWSDLAYTIPAILNFGLFGIPMVGADIC
GFSGNTNEELCRRWIQLGAFYPFARDHSEKFTIRQELYLWDSVAATARKVLGLRYRLLPL
FYTSMYEAHKKGTPIARPLFFSFPQDIRTYEINTQFLIGRGVMVSPVLKPGVSSVDAYFP
AGNWFDLFNYSNSVSVKSGEHVTLDAPPDHINVHVREGNILALQGEALTTEAARKTAFEL
LVVSSSNGQSTGEVFLDDGEEVEMEGEGGKWSLVRFYCATENGSVSVRSTVVNGGFALSQ
KWIIDKVTIIGLDKVDGLEGYALNITKGANLKGGHSDIRASFDSNKRFVMVEISRLSVLI
GADFNLELKY
NT seq 2733 nt NT seq  +upstreamnt  +downstreamnt
atgaagatgcaaagaagcagaccaaacaaaccaaaaccaatatatcatcttccactcttc
ttcttcttcttcttcttcttcctgtctgctgtctttcactgtggtttagcttcatcatca
aataccaagggagcaaaagaagctgcagttgctgggtttggatacaaaattcagtctgtc
aactatgattcttctgggaactcattgactgctaatcttggcctcatcaagaaatcctcc
gtctacggacctgacatcccaaatctcaaccttcacgccagctatgaaaccaaagatcgg
ctaagaattcgaattacagactcaaagcaccaaagatgggaaatcccacaacaaataatc
ccccgccaaacaacttcacagcatccacaacaatgtcaaacccgcaacaaacacctcgtc
atctccaacgaccttgtcttcactctccacaacaccaccccattcggcttcaccgtcacc
cgccaatcctccaaagacgtcattttcgactcctcccccaacccatcaaaccccgacacc
ttcttggtcttcaaggaccaatacatccagctctcctcctccctccccaaagccaggtcc
tccctttttggcctcggcgagcacaccaagtcctccttcaagctcacccccaaccagacc
ttgacactctggacagctgacattgccagcgccaatgctgacgtcaacctctacgggtcc
caccccttctacctggacgtcaggtcagcttctccagatggcaaggccgacagcgccgga
acatctcatggagtgttgctgctgaatagcaatggcatggacataacatacggcggtgat
agaattacttataaggccattggtggaattgtggatttgtatttcttttctgggccaacg
ccggagttggtggtggagcagtatacagagctcattggtcgccctacccctatgccgtat
tggtcttttggatttcaccagtgtcgatatggttacaagaatgtttccgatcttgggggt
gtggttgctggctatgcaaaagccgctatccctcttgaagttatgtggacagacattgat
tacatggatgcatacaaggattttactcttgatcccatcaacttcccattggataagatg
aagaaatttgtcaacacccttcaccaaaatgatcagaaatatgtgctcatcttggaccct
ggaatcagtgtgaataagagctatggaacctacaacagagggctgaaagcagatatattt
ataaaacgtgacggaattccttacctgggaagtgtttggcctggccctgtctatttccct
gactttgcacatccacaaagtgaaaatttttgggctaatgagataaaaatatttcaagat
gctctgcctttcgatggtctttggcttgatatgaatgagctatccaatttcatcacgtcc
cctcccactccatcttctacacttgatgaccctccttacaagattaacaatgccggggta
ctgcgtcccatcaataacaatactgttccggcatcagctctacacttcggtaacatcaca
gagtatgatgctcataacttatatggactcttggaatccaaagcaacaaacaaggcctta
gtcgatgtgactggtaaaagaccatttatactttctagatctacttttgtaagctctggt
aggtacacagcacactggactggagacaatgctgcaaaatggagtgatctggcatacaca
attccagcaattctgaattttggactctttggaattccgatggttggagctgatatatgt
ggattctctggaaatactaatgaagagctctgccgtcggtggattcagctaggggccttt
tacccttttgcaagagatcactcagagaagttcacaatccgtcaagagctctatctttgg
gactcggtggctgcaacggcaaggaaggtgcttggcctgcgctatcggttgctccccttg
ttttacacatcaatgtatgaggcacacaaaaaggggacccccattgcaagaccccttttc
ttctcatttcctcaagatatcagaacttacgagatcaacactcagtttctgattggcaga
ggtgtaatggtgtcacctgtgttgaagccaggagtaagttcagttgatgcatattttcct
gcaggaaactggtttgatctcttcaactactcaaactcggtaagtgtaaaatcgggagag
cacgttacactggatgcaccacctgatcatatcaacgtacatgtccgtgaaggaaacatt
ttggccttacaaggagaggccttgacaacagaagcagcccgaaagactgcattcgaactt
ttggttgttagcagtagcaatggacagagcactggagaagttttcttggatgatggagag
gaagtggaaatggaaggagagggaggcaagtggagtttagtgagattttactgtgcaaca
gaaaatggaagtgtatctgtaagatcaacggttgtaaatggaggatttgctttaagccaa
aaatggatcattgataaagttaccatcattgggttggacaaggttgatggattggaaggg
tatgcattgaacattactaagggagcaaacttgaagggaggacactcagatatcagggcc
agctttgacagcaataagcgattcgtcatggtagagatttccagattatctgttcttata
ggagcagattttaacttggagctgaagtattga

DBGET integrated database retrieval system