KEGG   Prunus mume (Japanese apricot): 103325850Help
Entry
103325850         CDS       T03196                                 

Definition
(RefSeq) probable glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
pmum  Prunus mume (Japanese apricot)
Pathway
pmum00480  Glutathione metabolism
pmum01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmum00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    103325850
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pmum02000]
    103325850
Enzymes [BR:pmum01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     103325850
Transporters [BR:pmum02000]
 Other transporters
  Pores ion channels [TC:1]
   103325850
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C GST_N_4 GST_C_6 GST_C_5 GST_C_3
Motif
Other DBs
NCBI-GeneID: 103325850
NCBI-ProteinID: XP_008226264
LinkDB All DBs
Position
LG3
AA seq 215 aa AA seqDB search
MGDEVVLLDFWASMFATRVRVALAEKGVKYENREEDLWNKSSLLLQMNPVHKKIPVLIHN
GKPICESLIIVQYVDEVWRDKAPLLPSDPYQRARSRFWADFIDKKLYVASRKIWGTKGEE
QEAGKKEFIEALKQLEGELGDKPYFEGESFGFLDIALISFYSWFYAYETFGNFSTEAECP
KLIEWAKRCMQRESVSKSLADPKKVYESVTSWVGL
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgggggatgaggttgttcttttggacttctgggcaagcatgtttgcaacgagggtgaga
gtggcgctggctgagaagggtgtcaagtatgagaacagagaggaggacttgtggaacaag
agttcattgcttctgcagatgaacccggttcacaagaagatcccagttctcatccacaac
ggtaaaccgatctgtgagtctctgatcattgtgcagtatgttgatgaggtttggagggac
aaagctcctctgcttccttctgatccttaccagagagctcggtcaaggttctgggctgac
ttcattgataagaagctatacgttgcttcgaggaaaatatggggcacaaaaggagaggaa
caagaggcaggcaagaaggaattcattgaagcccttaagcagttggaaggagagcttgga
gacaagccttattttgagggtgagagctttgggttcttggacattgctcttatctcattc
tacagctggttctatgcatatgagacttttggaaatttcagcacagaggcagagtgcccc
aagctgattgaatgggccaagaggtgcatgcagcgggagagcgtgtcgaaatctcttgcc
gacccaaaaaaggtgtatgagtctgtcactagttgggtaggattatag

DBGET integrated database retrieval system