KEGG   Prunus mume (Japanese apricot): 103326203Help
Entry
103326203         CDS       T03196                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn], chloroplastic
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
pmum  Prunus mume (Japanese apricot)
Pathway
pmum04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:pmum00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    103326203
Enzymes [BR:pmum01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     103326203
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu UPF0016
Motif
Other DBs
NCBI-GeneID: 103326203
NCBI-ProteinID: XP_008226630
LinkDB All DBs
Position
LG1
AA seq 223 aa AA seqDB search
MQAALAAMAAHTLMLSTYSSPTLFSQIQSPNSHPLPHSSFHGLSVKLPLKSQFQSMSLAA
AHKPLTVVAATKKAVAVLKGNSSVEGVVTLSQEDDGPTTVNVRITGLTPGPHGFHLHEYG
DTTNGCISTGPHFNPKNLTHGAPEDEIRHAGDLGNIVANANGVAEATIVDNQIPLTGPNA
VIGRALVVHELEDDLGKGGHELSLSTGNAGGRLACGVVGLTPV
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcagccttggcagccatggcagcccacactttgatgctctcaacctactcatct
cccactctcttctcccaaattcaaagccctaactctcacccacttcctcactcctccttt
catggcctctctgttaagctcccactcaaatcccaattccaatccatgtctctcgccgca
gcccataagcctctcactgtggttgccgccaccaagaaagccgtcgctgtcctcaagggc
aattccagtgtcgaaggggtcgtcaccttaagccaagaagacgatgggcctacaactgtg
aatgttcgtattactggacttactcctgggcctcatgggttccacttacatgagtacggt
gacacaacaaatggatgcatatccacaggaccacatttcaatcctaaaaatttgacacat
ggtgctcctgaggatgaaatccgtcatgcgggtgacctgggaaacatagttgctaatgcc
aatggggtggcagaggcaacaatcgtggataaccagattccattaactggtcctaatgct
gtaattggaagagcacttgtcgttcatgagcttgaggatgaccttggaaagggtggacac
gagcttagtctaagcactggcaatgcaggtggaagattggcatgtggtgtggttggtttg
acaccagtgtaa

DBGET integrated database retrieval system