KEGG   Prunus mume (Japanese apricot): 103328478Help
Entry
103328478         CDS       T03196                                 

Definition
(RefSeq) phosphoenolpyruvate carboxylase 2
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
pmum  Prunus mume (Japanese apricot)
Pathway
pmum00620  Pyruvate metabolism
pmum00710  Carbon fixation in photosynthetic organisms
pmum01100  Metabolic pathways
pmum01200  Carbon metabolism
Module
pmum_M00168  CAM (Crassulacean acid metabolism), dark
pmum_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
pmum_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
pmum_M00172  C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:pmum00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    103328478
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    103328478
Enzymes [BR:pmum01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     103328478
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-GeneID: 103328478
NCBI-ProteinID: XP_008229092
LinkDB All DBs
Position
LG4
AA seq 966 aa AA seqDB search
MASRNLEKMASIDAQLRLLAPGKVSEDDKLIEYDALLLDRFLDILQDLHGESLRETVQDC
YELSAEYERKQDPKKLEELGKVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRIK
LKKGDFADEASATTESDIEETLKRLVGDLKKSPQEVFDALKNQTVDLVLTAHPTQSVRRS
LLQKHARVRNCLTQLYAKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGM
SYFHETIWKGVPKFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR
DVCLLARMMAANLYFSQIEDLMFELSMWRCNDELLSRAHELHRSSRKDAKHYIEFWKQIP
PNEPYRVILGDVRDKLYSTRERARQLLANGISEIPEETTFTNVEQFLEPLELCYRSLCSC
GDRPIADGSLLDFLRQVSTFGLSLVRLDIRQESDRHTDVLDAITRHLEIGSYREWSEERR
QEWLLSELSGKRPLFGSDVPKTEEIADVLDTFHVISELPSDNFGAYIISMATAASDVLAV
ELLQRECGVKKPLRVVPLFEKLADLEAAPAAVGRLFSIDWYKNRINGKQEVMIGYSDSGK
DAGRLSAAWQLYKAQEELIKVAKQYGVKLTMFHGRGGTVGRGGGPTHLAILSQPPDTIHG
SLRVTVQGEVIEQSFGEEHLCFRTLQRFTAATLEHGMHPPVSPKPEWRALMDEMAVIATK
EYRSIVFQEPRFVEYFRRATPEMEYGRMNIGSRPSKRKPSGGIESLRAIPWIFAWTQTRF
HLPVWLGFGAAFKQAIEKDAKNLHMLREMYNQWPFFRVSIDLIEMVFAKGDPGIASLYDK
LLVSEDLWSFGERLRANYEETKSLVLQVAGHRALLEGDPYLRQRLLLRDSYITTLNVCQA
YTLKQIRDPNYHVKVRPHLSKEYMETTSKPAAELVKLNPTSEYAPGLEDTLILTMKGIAA
GMQNTG
NT seq 2901 nt NT seq  +upstreamnt  +downstreamnt
atggcttcaaggaacttggagaagatggcttcaattgacgcacagctgaggctgctggca
ccagggaaggtgtctgaggatgacaaactgattgagtatgatgctttgttattggatcgc
ttccttgacattcttcaggatttacatggagagagtctcagagaaacggtgcaagattgt
tatgaactttccgcagaatatgaaagaaagcaggaccctaaaaagttggaggaacttggg
aaggttctaacgagtttggatcctggggactcgattgtcattgctaagtccttttctcac
atgcttaacttagccaatttggccgaggaagttcagattgcttatcgaaggaggatcaag
ttgaagaagggagacttcgctgatgaggcttcagctactacagagtcagacattgaagag
actctcaagaggcttgtgggagacctgaagaagtccccacaagaagtttttgatgcgttg
aagaaccagactgtagatttggtcctaacagcacatcctactcagtctgttcgaagatcc
ttgcttcaaaagcacgcaagggtaagaaattgtttgacacagttgtatgctaaggacatt
acacctgatgataaacaggaactcgatgaggctctacaaagagagattcaagctgcattt
cgtacagatgaaatccgaaggactcctccaacccctcaagatgagatgagagcgggaatg
agctactttcatgagacaatttggaaaggtgtaccgaaattcttacgtcgtgttgacact
gctttgaagaacatagggataaatgaacgtgttccttacaatgcccctctcattcaattt
tcttcttggatgggtggggaccgtgatggaaaccccagggtcactcctgaagttacacgg
gatgtatgtttattggctagaatgatggctgctaacttgtacttctcccagatagaggat
cttatgtttgagttatctatgtggcgctgcaatgatgagcttctttctcgtgctcatgaa
cttcataggtcttcaaggaaggatgcgaaacactatatagagttttggaagcaaattcct
ccaaatgagccttatcgcgttattcttggtgatgtaagagacaagctatacagtacacgt
gaacgtgctcgccaattattggccaatggaatctctgaaattcccgaggaaacaaccttt
acaaatgttgaacagttcctggagcctctcgaattgtgttaccggtcactctgctcttgt
ggcgatcggccaattgctgatggaagccttcttgatttcttacggcaagtttccactttt
gggctctctcttgtgagactagacatacggcaagaatcagacaggcacactgatgtccta
gatgctataacaaggcacctggagattgggtcttatcgagaatggtccgaggaacgtaga
caagaatggctcttgtctgagcttagtggcaagcgccccctttttggctctgacgttccc
aagactgaagaaattgctgatgtgctggacacattccatgtcatttcagaacttccctca
gacaattttggtgcttatattatctcaatggcgacagcggcatctgatgtgcttgctgtt
gagcttttgcaacgtgaatgtggtgtgaagaaaccactaagggttgtcccattgtttgag
aagcttgctgatcttgaggctgctcctgctgctgtgggccgtctcttttcaatagattgg
tacaaaaacaggatcaatgggaagcaagaagtcatgataggatactcagattcagggaag
gatgctggccgtctatctgcagcatggcagttatacaaggctcaagaagagctcataaag
gttgcgaaacaatatggggttaagcttacaatgtttcatggtcgaggtggaacagttgga
agaggaggagggcccacccatcttgctatattgtctcagccacccgacacaattcatggt
tcacttcgtgttacagttcaaggtgaagttattgaacaatcatttggggaggagcacttg
tgctttagaacactccagcgtttcacagcagctacacttgagcacggaatgcatcctcct
gtctcaccaaagcctgaatggcgtgcactaatggatgagatggctgtcattgcaacaaag
gaataccgttcaatagttttccaggaacctcgttttgttgaatactttcgccgtgcaaca
ccagagatggagtatggccggatgaacattgggagtcgtccttcaaaacgaaagccaagt
ggaggcattgaatcactacgtgcaatcccatggatatttgcttggacccaaacaagattt
catttaccagtgtggcttgggtttggggcagcatttaagcaagctattgagaaggatgcg
aaaaatctccatatgcttcgagagatgtataatcagtggcctttcttcagagtgtcgatt
gatttaattgagatggtgtttgccaagggcgacccgggtattgcctctctgtatgacaag
ctgcttgtgtcagaagacctatggtcatttggagagagattgagggccaactacgaagaa
actaagagccttgtcctccaggttgctggacatagggctcttctggaaggagatccttat
ttgaggcagagactccttctccgtgactcttacatcaccacacttaatgtgtgccaagcc
tatacactgaagcagattcgagatccgaactaccatgtgaaagtaaggccacacttgtca
aaggagtacatggaaacaacaagcaagccagcggcagagctcgtaaagcttaatccaact
agcgagtatgctcctggactagaagacacacttattttgactatgaagggtattgctgct
ggcatgcagaataccggatga

DBGET integrated database retrieval system