KEGG   Prunus mume (Japanese apricot): 103328690Help
Entry
103328690         CDS       T03196                                 

Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
pmum  Prunus mume (Japanese apricot)
Pathway
pmum03030  DNA replication
pmum03410  Base excision repair
pmum03420  Nucleotide excision repair
pmum03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:pmum00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    103328690
   03410 Base excision repair
    103328690
   03420 Nucleotide excision repair
    103328690
   03430 Mismatch repair
    103328690
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:pmum03032]
    103328690
   03400 DNA repair and recombination proteins [BR:pmum03400]
    103328690
Enzymes [BR:pmum01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     103328690
    6.5.1.6  DNA ligase (ATP or NAD+)
     103328690
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     103328690
DNA replication proteins [BR:pmum03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    103328690
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     103328690
DNA repair and recombination proteins [BR:pmum03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     103328690
   NER (nucleotide excision repair)
    Other NER factors
     103328690
   MMR (mismatch excision repair)
    Other MMR factors
     103328690
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DRMBL DNA_ligase_A_C RMMBL UBA_4 CDT1_C
Motif
Other DBs
NCBI-GeneID: 103328690
NCBI-ProteinID: XP_016649480
LinkDB All DBs
Position
LG4
AA seq 1153 aa AA seqDB search
MESLRATYVIGKEKILLEIARRCNRKVHVDAQKMAVLRVLGYGESGVFTEDECESDVHVV
GWNVLGETWPYFRPNFVKMKEIMVEKGYSKVVGFVPTGWTYEVKRNKFSVRSKDSFEIHL
VPYSEHSNYDELREYVRFLKPKHVIPTVGLDVEKLDSKHANKMQKHFAGLVDEMANKKEF
LRGFLLGSTEVGNSVENESNNGPIEGLDQEKGAMPSDKDTVHMELSSSLQEPDPQNPMVL
NDEEAEKIIQELRDCLPTWVTQEQMLDLIGSSGGDIVESVSNFYERETEFHEQVISSTIA
VSESQTSSLCDSGSLPKGGSVKSSPYGSTDVPSSQEYISLKPRNVIKSGISPGKRARNTN
NKVNKKVKLNSKLDSRGPKQLAITKFFSKVLPDVQETPEIGSMDEQNVKDESLPHDDTKS
YRDEIDQFLQIIDGTESLESYAATILRKTNGDINEALNIYYCNREVRSGKNEAGLVVDSG
KMKPTADSSVEVSLQEKVKTTVLSLPPEKYDPTEDACWSCGQRAPYLHLARTFDLLEDEK
GKIKATSMLCNMFRSLLALSPEDVLPSVYLCTNKIAADHENVELNIGGSLVTSALEDACG
TSRSKIREMYNELGDLGDVAQACRQTQKLLAPPSPLLIKDVFFALQKISVQTGSGSTGRK
KSLIVNLMRSCREKEMKFLVRTLVRNLRIGAMMKTVLPALAQAVVMNSSHNFNHEGAVQS
LKDRLQLHSAAVVEAYNVLPNLDLVVPSLMDKGIGFSSSTLSMVPGIPIKPMLAKITNGV
QQALKLLGNKAFTCEYKYDGQRAQIHKLVDGSVRVFSRNGDESTSRFPDLIKIINESCKP
DAVTFILDAEVVAIDRKNGLKLMSFQELSSRGRGSRDTSITLDSIKVDICVFIFDIMFAN
GQQLLGFPLRKRRKYLKDMFYDEKLGYFEYAKEMTVEADDACLTSEATLTKINCFLENAF
LSSCEGIMVKSLDVDAGYSPSKRTDTWLKVKRDYMEGSNDSLDLVPIGAWHGNGRKAGWY
SPFLMACYNPDTEDFQSVCRVMSGFSDSFYTEMKSFFSGDKILSRKPLYYKTAEAPDMWF
PPELVWEIRGADFTVSPVHQAAVGLVHPSRGISIRFPRYVRTVADRKPDECSTSEDIAAM
FCSQTRKMDVAED
NT seq 3462 nt NT seq  +upstreamnt  +downstreamnt
atggaaagtttgagagctacttatgttattgggaaagagaagattttgctggaaattgct
cgtaggtgtaatcgtaaagtacatgtggatgctcaaaaaatggcggtgttgcgtgttttg
ggctacggagagagtggggtatttacagaggatgagtgcgaaagtgatgtacatgttgtt
gggtggaatgtcttgggcgagacttggccatattttaggcctaattttgtgaaaatgaag
gagattatggttgagaaaggatactctaaggttgtgggttttgttcctactggttggact
tatgaagtgaagcgtaacaagttttcagtgaggtcaaaggattcatttgagatccatctt
gtaccgtatagtgaacattctaactatgatgaacttagggaatatgtgaggtttttgaaa
ccaaagcatgttattcctacggtgggcttggatgttgaaaagcttgatagtaagcatgcc
aataaaatgcaaaagcattttgctgggttagtcgatgaaatggcaaacaagaaagagttc
ttgaggggctttcttcttggatccacagaagttggtaacagtgttgaaaatgagtccaac
aatggtcctattgaagggctggatcaagagaaaggggcaatgccatctgataaggatact
gtgcacatggaattatcatcttctctacaagaacctgatccacaaaatccaatggtatta
aatgatgaagaagcagagaaaatcattcaagaacttcgtgattgtttgcccacatgggtc
actcaagagcagatgttagatctgattggaagctcaggaggggacattgttgaatcagtt
tccaatttttacgaacgtgaaacagaatttcatgagcaagtaatttcttctacaattgct
gtttctgaatcccagaccagctcactttgtgactctggatcactcccaaaaggaggttct
gttaagagcagtccatatggaagtactgacgttccttcaagtcaagaatatatctcactg
aagccaaggaatgtaattaaaagtggaatttctcctggaaaaagggcgagaaacactaat
aataaggtaaacaaaaaagttaaattaaattccaaattggattcacgtgggccaaagcaa
ctggcaataacaaagttttttagtaaagttttgcctgatgttcaagaaactccggagatt
ggatcaatggatgaacaaaacgttaaagatgaaagtttgccccatgatgacaccaaatca
tacagagatgagatagatcagtttcttcagataatagatggtactgaatcattagaaagc
tatgctgccaccattctgaggaagacaaatggagatatcaatgaggcgctgaatatatat
tactgtaatcgcgaggttaggtctggtaaaaatgaagcaggattggtggttgattcaggg
aaaatgaagccaacagctgattcatctgtggaggtatcattacaagagaaagtaaaaaca
actgttctgtcattaccaccagaaaaatacgatcctacagaagatgcgtgctggagctgt
ggacagcgcgctccgtatttacatcttgcacgaacttttgacttacttgaggatgaaaaa
ggcaagataaaagctacttctatgctctgcaatatgttcagaagtttgcttgccttgtct
cctgaggatgtgctgccttcagtgtatttgtgcacaaataagattgctgcagaccatgaa
aatgtggagctaaacattggtggaagtttggtcacatcagcattggaagatgcatgtggt
acaagccgatccaaaataagggagatgtacaatgagttgggtgatctaggtgatgtggct
caagcatgccggcagacacagaagctacttgcccctccttcaccgcttctaataaaagac
gtatttttcgcactccaaaagataagtgtacaaacaggtagtgggagcactggtcgaaag
aaaagcctcattgtgaatctcatgcgctcttgtagagagaaagaaatgaagtttcttgtt
agaactttggttaggaatttgcggattggagcaatgatgaaaactgttctacctgctctg
gctcaagctgttgtcatgaattcctctcataacttcaatcatgaaggagcagtacaaagt
ttgaaagataggcttcagctccattcagcagctgtagtcgaagcatacaatgtactgccc
aatttggatttggtcgttccttctctcatggacaaaggcattggattctcttcatcaact
ttgtcaatggttccaggaatacctattaagccaatgcttgcaaaaatcacaaatggtgtt
cagcaagcactaaaactcttaggaaataaagcttttacctgtgaatacaaatacgatggt
cagcgtgcccaaattcataaattagttgatgggtctgtgcgtgttttttcacgaaatggg
gacgaatcaacgtcaagatttccagatctgatcaagataataaatgaatcttgtaagcct
gatgcagtcactttcatactagatgcagaggtggttgcaattgataggaagaatggtctg
aagctaatgtctttccaagagttgtcttcacgtgggagagggagcagagatacatcaatt
acattggatagcataaaggtcgacatttgtgtatttatctttgatatcatgtttgccaat
ggacagcagttgttgggctttcctctaaggaaaagacgaaaatatttgaaagatatgttt
tatgatgagaagttgggttattttgagtatgccaaggaaatgacagtcgaagcagatgat
gcttgtttaaccagtgaagcgacgttaacgaagatcaactgttttctcgaaaatgcattc
ctctcctcatgtgaagggattatggttaaatctttagatgttgatgctggatattctcca
tcaaagcgtacagatacatggttaaaggtaaagcgagactacatggaaggatcaaatgac
tctcttgatttagtcccaattggagcttggcatggaaacgggagaaaggcaggctggtac
agtccatttcttatggcatgttataaccctgatactgaggatttccaaagcgtctgccgt
gtcatgtctgggttctcagattcattttacactgagatgaaaagtttcttttctggagac
aagatcttgtccagaaaaccactttattataaaaccgctgaggcgcctgatatgtggttt
cctccggaacttgtatgggaaataagaggtgcagactttactgtgtcccctgtccaccaa
gctgccgtaggtttagttcatccatcacgtggaatttcaatcagattcccaagatacgtt
cgcactgtggctgatagaaaaccagatgaatgtagcacatctgaagatatagctgcgatg
ttttgttcccagacaaggaagatggacgttgctgaagattga

DBGET integrated database retrieval system