KEGG   Prunus mume (Japanese apricot): 103332475Help
Entry
103332475         CDS       T03196                                 

Definition
(RefSeq) glycerol-3-phosphate dehydrogenase SDP6, mitochondrial
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
pmum  Prunus mume (Japanese apricot)
Pathway
pmum00564  Glycerophospholipid metabolism
pmum01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pmum00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    103332475
Enzymes [BR:pmum01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     103332475
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored FAD_binding_2 Pyr_redox_2 NAD_binding_8 Pyr_redox
Motif
Other DBs
NCBI-GeneID: 103332475
NCBI-ProteinID: XP_008233440
LinkDB All DBs
Position
LG5
AA seq 633 aa AA seqDB search
MRPTPSPAPLSPKRKSLFSSTNGKHISNGIQPSYSASDRGSGPASIAAVRQRISDRNAVV
PPRAVQESALIAATAENPLDILVVGGGATGSGVAFDAVTRGLRVGLVEREDFSSGTSSRS
TKLIHGGVRYLEKAVFNLDYGQLKLVFHALEERKQVIENAPHLCHALPCMTPCFDWFEVV
YYWMGLKMYDLVAGLRLLHVSRYYSAQESVELFPTLARKGNNKSLKGTVVYYDGQMNDAR
LNVGLACSAAVAGAAVLNHAEVVSFLKDEASNRTIGARIRDNLSGKEFDTYAKVVVNAAG
PFCDSVRKLADKDVKPMICPSSGVHIVLPDYYSPEGMGLIVPKTKDGRVVFMLPWLGRTI
AGTTDSNTPITLLPEPHEDEIQFILDAICDYLNVKVRRTDVLSAWSGIRPLATDPSAKNT
ESISRDHVVCEDYPGLVTITGGKWTTYRGMAEDAVNAAIKSGKLTPQNGCLTSKLQIVGG
DGWDPASFTVIAQQYTRMKKSHGKVVPGVMDTAAAKHLSHAYGTWAERVAAIAQNENLGK
RLAHGYPILEAEVAYCARNEYCESAIDFIARRSRLAFLDTDAASRALPRVIEILASEHNW
DDLRQTYELKKAKEFLETFKSSRNAQFHDGKHV
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atgcggccaaccccctccccagctcccctttcccccaaaagaaaatcactattttcttca
acaaatggaaaacacatctctaatggcatccaaccgtcgtactccgccagcgaccgcggc
agtgggcctgcctccatcgcagctgttcgccagaggatcagcgaccgcaacgccgtcgtt
ccgcccagggcggtccaggagtctgctctgatcgctgccaccgccgagaacccgctcgac
attctcgtggtcggcggtggcgccaccggcagtggagtcgcttttgacgctgtcacccga
ggcctccgcgttggtctcgtcgagcgcgaggacttctcatctggcacgtcgtcgcggtcc
acgaagctaattcacggaggtgttcggtacttggagaaagctgtttttaatcttgactac
gggcagctgaagctggtattccatgcgcttgaggagcgtaaacaggttattgagaatgca
ccacacctctgccatgctttgccatgcatgacaccatgttttgactggtttgaggtagta
tactactggatgggcttgaaaatgtacgatttggtcgcaggactacgcctgttacatgtg
tctagatattattcggcacaagaatctgttgagctcttccccactcttgcgaggaagggt
aacaataaaagcttgaagggcaccgtggtgtattatgatgggcagatgaatgacgcacgt
ctaaatgttggattggcgtgctctgctgcagtagctggtgcagcagtgcttaaccatgca
gaagtggtttcgtttttgaaggatgaggctagcaatcggacaattggtgcaagaatccga
gacaatttatcaggaaaagagtttgacacatatgcaaaagttgttgtgaatgctgctggg
ccattttgtgattctgtaaggaagctggcagacaaagatgtaaagcctatgatatgtcca
agcagtggtgtacatatcgtacttcctgattattattctcctgaaggtatgggtttgatt
gttcctaaaactaaggatggacgtgttgtttttatgctaccgtggttgggacgaacaatt
gctggcaccactgattccaacacccctattactctgcttcctgaaccacacgaggatgag
attcaattcatactggatgccatttgtgattacctgaatgtcaaggtacgacgcacagac
gttctctctgcatggagtggtattcgcccattggcaacagatccatctgcaaaaaacacc
gagagcatctccagagatcatgttgtatgtgaagattatcctggtttggtaacaatcaca
ggtggcaagtggaccacttaccgtggcatggcagaagatgcggttaatgcagcaataaag
tctggaaagctcaccccacaaaatggatgtttgacctcgaagctgcagattgtcggtgga
gatggatgggaccctgcatcttttacagttattgctcaacaatatacacgcatgaagaaa
agtcatggtaaagttgttcctggagtgatggacactgctgcagcaaagcatctgtcccat
gcatatggtacttgggctgaacgagttgctgccattgctcagaatgaaaatctggggaag
aggcttgcccatggataccctattctagaggctgaggttgcttactgtgctcgaaatgag
tactgtgaatctgccattgatttcattgctcggagatctcggcttgctttcctcgatacc
gatgcagcaagcagggcattgcctcgtgtaattgaaatattagcttctgaacacaactgg
gatgatttgaggcagacgtacgagttaaagaaggccaaagaatttttggaaaccttcaaa
tcttcaagaaatgctcagttccatgatgggaaacatgtttag

DBGET integrated database retrieval system