KEGG   Prunus mume (Japanese apricot): 103336359Help
Entry
103336359         CDS       T03196                                 

Definition
(RefSeq) protein MITOFERRINLIKE 1, chloroplastic
  KO
K15111  solute carrier family 25 (mitochondrial S-adenosylmethionine transporter), member 26
Organism
pmum  Prunus mume (Japanese apricot)
Brite
KEGG Orthology (KO) [BR:pmum00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pmum02000]
    103336359
Transporters [BR:pmum02000]
 Solute Carrier Family (SLC)
  SLC25: Mitochondrial carrier
   103336359
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mito_carr
Motif
Other DBs
NCBI-GeneID: 103336359
NCBI-ProteinID: XP_008237623
LinkDB All DBs
Position
LG6
AA seq 389 aa AA seqDB search
MENRLSASLGLPSPNQNHYHHHLHSQTSNDFHSLFTHFITPNSQSSLTPTQNHIPFFAST
TSTTTSPSPNWFSNSRPNTRPKTQILLKNLTVFERALIGAGGGGIAGAFTYFCLHPLDTI
KTKLQTRGASDIYANAFDAVLKTFQTKGISGFYSGISAVIVGSTGSSAIYFGTCELGKSV
LSKLPNYPPVLIPPTAGAMGNIVSSAIMVPKELITQRMQAGAKGRSWQVLLKILENDGVL
GLYAGYSATLLRNLPAGVLSYSSFEYLKSAVLSKTKQTHLEPLQSVICGALAGAISASIT
TPLDVVKTRLMTGAAKSGVSGTVKQILMEEGWVGLTRGVGPRVLHSACFSALGYFAFETA
RLAILNQYIKRKELQMQELAVDVGVASST
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atggagaacagactctcagcttctctaggcctcccctcacccaatcaaaaccactaccac
caccacctccattcccaaacctccaatgacttccatagcctcttcactcatttcatcacc
ccaaattcccaatcttccctcaccccaacccaaaaccacatcccattctttgcttccacc
acgtccacaaccacctccccctccccaaattggttctccaattcccgacccaacacccgg
cccaagacccagattttactgaagaacctcacggtgttcgagcgtgccctcatcggcgca
ggcgggggaggcatcgccggagccttcacctacttctgcctccaccctctggacaccatc
aagacgaagctccagaccagaggcgcctcagacatttacgcaaacgccttcgacgcagtc
ctcaagaccttccagaccaagggcatctcgggattttacagtggcatctccgccgtcatc
gtcggctccaccggttcctccgccatctacttcggcacctgcgagctgggtaagtcggtg
ctctccaaattacccaactaccctcccgttcttatccctcccacggccggagccatgggc
aatattgtctcttccgcgattatggtcccgaaggagctcatcacgcagagaatgcaagcc
ggggccaaagggaggtcgtggcaggtgctgttgaagatcctggaaaacgacggcgtcttg
ggtctgtacgcagggtactctgcgacattactgaggaacttgcctgcgggtgtcttgagc
tattcttcgttcgagtatttgaaatctgctgttctgagcaagacgaagcaaacccatttg
gagccgctacagagcgtgatctgtggggcattggccggtgcaatatcggcctccattacg
actccgcttgatgtggtaaagacgaggctgatgactggtgctgcaaagagtggggtttcg
gggacggtgaagcagattttaatggaggaagggtgggtggggttgacgagaggagttggg
cccagagttcttcacagcgcttgcttttctgctttgggttactttgcgttcgagactgcc
aggcttgccattttgaatcagtatattaagaggaaggagctgcaaatgcaagaattggct
gttgacgttggtgttgcttcctccacttga

DBGET integrated database retrieval system