KEGG   Prunus mume (Japanese apricot): 103339907Help
Entry
103339907         CDS       T03196                                 

Definition
(RefSeq) histone-lysine N-methyltransferase CLF isoform X1
  KO
K11430  histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
pmum  Prunus mume (Japanese apricot)
Pathway
pmum00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:pmum00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    103339907
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pmum03036]
    103339907
Enzymes [BR:pmum01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     103339907
Chromosome and associated proteins [BR:pmum03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     103339907
   Polycomb group proteins
    PRC2-EZH2 complex
     103339907
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET TCR
Motif
Other DBs
NCBI-GeneID: 103339907
NCBI-ProteinID: XP_008241485
LinkDB All DBs
Position
LG8
AA seq 914 aa AA seqDB search
MASKASPSASANRSEPHQEPPMTASQENMDVTRKEISLIIDSLKKQVVSNRGTSIKKRME
ENRQRLAGVTSNLYKLSMERGSSRFIDIGKSVDLLTKRQKDAFALQNGIDVSKDGSQEDG
HGSTAVLLESNVAVKSSVRPIKLPEVKRLPPYTTWIFLDRNQRMTEDQSVLGRRRIYYDQ
NGGEALICSDSEEEAVDEEDEKRDFVESEDYILSMAIKEVGFSDPVLESLAQCFSRSPSE
VKARYDTLVKEEEAVGGCKTMDNEDISQNGNYFLDKDLDAALDSFDNLFCRRCLVFDCRL
HGCSQDLVFPAEKQPSWSSPDAENASCGPNCYRSVLKSERIARVSSGDVEEKNVTSLDGA
QMSTRKKSSVISARKKVKSGQSESASSNAKAISESSDSENGPRQDATHHQTPSKTKLAGK
SGIGKRNSKRVAERVLVCMQKRQKKMVVSDSDSIVNAGLCPSDMKLRSNSCKDNEDTSSS
SQKNLKSSTSGGFRRKESPTKGRHKVVQVDVLDGSSDEIITDPPGTSSDDNLRKEECVDE
NIYKQELSDDKTWKTIEKGLFDKGIEIFGRNSCLIARNLLNGMKNCWEVFQYMNYSESKM
SCQEGDAANSLVEGHSKGNNEARRRSRFLRRRGRVRRLKYTWKSAAYHSIRKRITERKDQ
PCRQYNPCTCQTACGKQCSCLQNGTCCEKYCGCPKTCKNRFRGCHCAKSQCRSRQCPCFA
ADRECDPDVCRNCWVSCGDGSLGVPNQRGDNYECRNMKLLLKQQQRVLLGRSDVSGWGAF
LKNSVGKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQFVLDAYRKGDKLKFA
NHAPDPNCYAKVIMVAGDHRVGIFAKERITAGEELFYDYRYEPDRAPAWARKPEASGSKK
DDGAPSSGRAKKLA
NT seq 2745 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgaaggcttcgccttcagcttctgccaatagatcggagcctcaccaggaacct
ccgatgacggcatcacaagaaaacatggatgtaacccggaaggagatttcattgatcata
gattccctaaagaagcaagttgtttctaaccggggtacttccattaagaaaagaatggag
gaaaacaggcagaggttggctggtgtcactagcaatttgtataaattgtcaatggaaaga
ggaagtagtaggtttattgatattggcaaaagtgtagatctattgacaaagaggcaaaaa
gatgcatttgccttgcaaaatggaattgatgtaagtaaggatggctctcaagaagatggc
catgggtccacagcagttcttctagaatctaatgttgcagtcaagagttctgttcgtcct
atcaagcttccggaagttaaaagactacctccttatactacatggatatttttggacaga
aaccaaaggatgacagaggatcagtcagtgttaggtcgaagaagaatttattatgatcaa
aatggaggtgaagctcttatatgtagtgatagtgaggaggaggcagttgatgaagaagat
gaaaagagggactttgttgaatctgaagactacatacttagcatggctataaaagaagtt
ggcttctctgatccagtgctggagtcattagcacagtgtttctctagaagtccttctgaa
gtcaaggcaagatatgatactctcgtaaaggaagaggaggctgtggggggttgtaaaact
atggataatgaagacatttcacaaaatgggaattattttcttgataaagatctagatgca
gctctggattcatttgacaacctattttgtcgtcgatgccttgtgtttgattgcagatta
catggatgttcacaggatcttgtctttcctgctgagaaacaaccttcttggagctctccg
gatgccgaaaatgcatcatgtggtccaaattgctatcgatcagtactgaaatctgaaaga
attgctagagtgagctctggtgatgttgaagaaaaaaatgtcacatcattagatggtgct
caaatgtcaacgagaaagaagtcttctgttatatctgctagaaagaaggtaaagtctggc
caaagtgaaagtgcttcatctaatgcaaaagccatctcagaaagcagtgattcagagaat
ggacccaggcaggatgctactcatcatcaaacaccctcaaagactaagctagcaggaaaa
agtggaattggtaaaaggaacagcaagagagttgcagagcgtgttctagtttgcatgcag
aagaggcagaagaaaatggtggtttctgattctgattccattgttaatgctggtctttgt
ccaagtgatatgaagcttagatcaaattcatgcaaagataatgaagacactagttcttct
tcacaaaagaatctgaaatcttctaccagtggagggtttaggaggaaggaatcacctact
aagggcagacacaaagtagttcaggtcgatgttcttgatggttcatcagatgagataatc
actgatccacctggtactagtagtgatgacaatttgaggaaagaagagtgtgtggatgaa
aacatttataaacaagaattaagtgatgataaaacatggaaaactattgaaaaaggcctt
ttcgataaaggcatagagatttttggcaggaacagctgtttaatagcaaggaacctttta
aatggtatgaaaaattgctgggaggtttttcagtatatgaattactcagagagtaagatg
tcctgccaagaaggtgatgctgcaaattcccttgttgaaggacattccaagggtaataat
gaagcaagaagaagatcaagatttttacgtagaaggggtagagttcgtcgcttgaagtat
acttggaaatctgctgcttaccattcaatcaggaaacgaattactgagagaaaagatcag
ccttgcaggcagtataatccatgtacttgccaaacagcttgtggaaagcagtgttcttgt
ctacaaaatgggacttgttgcgagaagtactgtgggtgtcctaagacttgcaagaataga
tttaggggctgtcattgtgcaaaaagtcaatgccggagtcgtcagtgcccctgctttgct
gcggacagggaatgtgatccggatgtttgtaggaattgctgggtcagttgcggtgatggg
tcccttggggttccaaaccaaagaggtgacaattatgagtgtagaaatatgaagctgctt
ctgaaacaacaacagagggtcttacttggaagatctgacgtatctggctggggtgctttc
ttaaagaatagcgtcggcaagcatgaataccttggtgagtatactggggagttgatctca
catcgggaagcagataagcgtggaaaaatatatgaccgtgaaaattcatcatttctcttc
aatctgaacgatcagtttgtccttgatgcctatcgaaagggtgacaaattgaagtttgcc
aaccatgctccagatccgaattgttatgcaaaggtcattatggttgctggagatcatagg
gtgggcatatttgccaaggaacggattactgcaggagaggaacttttctacgattatcgt
tatgagccggatagagctcctgcctgggctcggaagcctgaggcatcgggatccaagaag
gatgacggtgctccttcaagtggtcgtgcaaagaagcttgcttaa

DBGET integrated database retrieval system