KEGG   Prunus mume (Japanese apricot): 103340079Help
Entry
103340079         CDS       T03196                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit 1, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
pmum  Prunus mume (Japanese apricot)
Pathway
pmum00020  Citrate cycle (TCA cycle)
pmum00190  Oxidative phosphorylation
pmum01100  Metabolic pathways
pmum01110  Biosynthesis of secondary metabolites
pmum01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pmum00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    103340079
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    103340079
Enzymes [BR:pmum01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     103340079
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA FAD_binding_3 Thi4 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 103340079
NCBI-ProteinID: XP_008241667
LinkDB All DBs
Position
LG8
AA seq 633 aa AA seqDB search
MWRCVSRRLGVPYSQRSVSSDSLRSHFSRLFSTESATGRSSYTVVDHTYDAVVVGAGGAG
LRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWL
GDQDAIQYMCREAPKAVIELENYGLPFSRTEDGRIYQRAFGGQSLDFGKGGQAYRCACAA
DRTGHALLHTLYGQAMKHNTQFFVEYFALDLLMNSDGSCQGVIALNMEDGTLHRFQAAST
ILATGGYGRAYFSATSAHTCTGDGNAMVARAGLPLQDLEFVQFHPTGIYGAGCLITEGSR
GEGGILRNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPLKDHIYLHLNHLP
PDVLKERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVTKKGNDPDVI
IPGLMAAGEAACASVHGANRLGANSLLDIVVFGRACANRVAEIHKPGEKQQPLEKDSGEQ
TIAWLDKIRNSNGSLPTSQIRLNMQRIMQNNAAVFRTQETLEEGSQLIDKAWESFDNVQV
KDRSLIWNSDLIETIELENLLINACITMHSADARKESRGAHAREDFTKRDDEKWMKHTLG
YWENEKVRLDYRPVHLNTLDDEIESFPPKARVY
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atgtggcggtgcgtttctcgtcgacttggcgttccttattcccagagatccgtctccagt
gactctcttagatctcacttctcgaggctcttctccactgaatccgctacagggcgctct
tcgtacactgtggtggaccacacttatgatgcagtggttgtcggggctggtggtgcaggg
cttagagcagccataggactttcagagcatggatttaataccgcttgcattacgaagctt
ttcccaactcgttcacatactgttgcagcccagggtggcataaatgctgcattagggaat
atgacagaggatgactggagatggcacatgtatgacacagtcaagggaagcgattggctg
ggtgatcaagatgccatccagtatatgtgcagggaggctccaaaagctgtgattgaactt
gaaaattatggattgccattttctcgaactgaagatggaagaatatatcagcgtgcattt
ggtggccaaagccttgacttcggaaaaggtggacaggcataccgctgtgcttgtgctgct
gacagaactggtcatgctctattacatactctttatggacaagctatgaagcataataca
caattttttgtcgaatattttgctttggatcttctaatgaacagtgatgggagctgccaa
ggagttattgcattaaatatggaggacgggactttgcatcggttccaagcagcgtcaaca
attttggccacggggggttatggtagagcatatttctctgcaacctcagctcatacctgc
actggagatggtaatgccatggtcgcacgtgctggactccctcttcaggatttggagttt
gtgcagtttcaccctactggtatatatggtgctgggtgcctcatcactgaaggatcacga
ggggaaggtggtatccttaggaacagtgaaggtgagcgatttatggaacgatatgcccct
acagcgaaagaccttgcttctagggatgttgtgtcaagatctatgactatggaaatccgg
gagggtcgtggtgtaggacctttgaaagaccacatctatctccacttgaatcatttgccc
ccagatgtactcaaggagaggcttcctggtatctctgaaactgctgccatttttgctggc
gtggatgttacaaaggagcctattcctgtcttacctaccgtgcattataatatgggtggc
attccgaccaattatcatggagaggttgttaccaaaaaaggtaatgatccagatgtaata
attcctgggttaatggcagctggggaggcagcctgtgcatctgtgcatggtgccaatcga
cttggtgcaaattcactccttgacattgttgtttttggccgagcttgtgcaaatagagtt
gcagagatccataaaccaggggagaaacaacagcctctggaaaaggattctggtgagcag
accattgcatggttggacaaaataaggaattcaaatggttcactaccaacttcgcaaatc
cggttgaatatgcaacgaataatgcaaaataatgctgctgtgttccgcacacaagaaaca
ttagaagaaggttctcagttgattgacaaggcatgggagagttttgataatgttcaagtg
aaggatcggagtttgatatggaactccgacttgatagagactatagagttggaaaacctt
ttgataaatgcctgtatcaccatgcattccgctgacgccaggaaagagagcagaggagca
catgctcgtgaagacttcacgaaaagggatgatgagaagtggatgaaacatactctagga
tactgggaaaatgagaaggtccgactagactacagaccagttcacttgaacacattagac
gatgaaatcgagtcattcccacctaaagcgcgtgtctactga

DBGET integrated database retrieval system