KEGG   Prunus mume (Japanese apricot): 103340810Help
Entry
103340810         CDS       T03196                                 

Definition
(RefSeq) hexokinase-1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
pmum  Prunus mume (Japanese apricot)
Pathway
pmum00010  Glycolysis / Gluconeogenesis
pmum00051  Fructose and mannose metabolism
pmum00052  Galactose metabolism
pmum00500  Starch and sucrose metabolism
pmum00520  Amino sugar and nucleotide sugar metabolism
pmum01100  Metabolic pathways
pmum01110  Biosynthesis of secondary metabolites
pmum01200  Carbon metabolism
Module
pmum_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pmum_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pmum00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103340810
   00051 Fructose and mannose metabolism
    103340810
   00052 Galactose metabolism
    103340810
   00500 Starch and sucrose metabolism
    103340810
   00520 Amino sugar and nucleotide sugar metabolism
    103340810
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    103340810
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pmum04131]
    103340810
Enzymes [BR:pmum01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     103340810
Membrane trafficking [BR:pmum04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    103340810
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 Rhabdo_ncap_2
Motif
Other DBs
NCBI-GeneID: 103340810
NCBI-ProteinID: XP_008242483
LinkDB All DBs
Position
LG8
AA seq 498 aa AA seqDB search
MGKVAVGAAVVCAAAVCAAAALVVRHRMKSSGRWARAMAILREFEDKCGTPIGKLRQVAD
AMTVEMHAGLASEGGSKLKMLISYVDNLPTGDEQGLFYALDLGGTNFRVIRVQLGGKEKR
VVKQEFDEVSIPPNLMTGTSEALFDFIAEALAKFVATEGEGFHPAPGRQRELGFTFSFPV
WQTSIASGTLIKWTKGFNIEDAVEQDVVGELTKSVEKIGLDMRVTALVNDTIGTLAGGRY
HNQDVIAAVILGTGTNAAYVERAHAIPKWHGLLPKSGEMVINMEWGNFRSSHLPLTEYDQ
ALDAESLNPGDQIFEKIISGMYLGDIVRRVLCKMAEEASFFGDVVPPKLKVPFILRTPDM
SAMHHDTSPDLRVVGSKLKDILEISNTSLKMRKVVVALCDIVATRGARLSAAGIMGVLKK
LGRDTVKEGEKQKSVVALDGGLYEHYTEFRTSMESTLKELLGDEVAEHISVEHSNDGSGI
GAALLAASHSQYLEVEES
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggggaaggtggcggtgggggcggcagtggtgtgcgcggcggcggtgtgtgctgcggcg
gcgctggttgtacgacaccgtatgaagagctcggggaggtgggcccgggctatggcgata
ctgagggagttcgaggataagtgtgggacccccatcgggaagctgagacaggtggctgac
gccatgactgtggaaatgcacgctggcctcgcatccgaaggcggcagcaagctcaagatg
ctcatcagctacgtcgataacctccccactggggatgagcaagggctgttttatgcattg
gaccttggtgggacaaacttccgcgtcatacgtgtacagcttggtgggaaagaaaaacgt
gttgttaaacaagaatttgacgaagtttcaattccaccaaatttgatgactgggacttca
gaagcattatttgattttattgctgaagcacttgcaaaatttgttgctacggaaggagaa
ggttttcatcctgctcctggtagacaaagggagctgggttttaccttttcatttcctgtg
tggcaaacatcaatcgcatcaggaacccttattaagtggacaaaaggcttcaatattgaa
gacgcggttgagcaagatgtggtgggagagctgaccaaatcagtggaaaaaattggcctt
gatatgcgtgttacagctttggtcaatgatacaattggtacattagcaggaggtagatac
cacaatcaggatgtcattgctgctgtgatattgggcactgggacaaatgctgcttatgta
gaacgggctcatgccattccaaaatggcatggtcttctacctaaatcaggagagatggtt
atcaacatggagtggggtaactttcgctcatcacaccttccactgacagaatacgatcaa
gcacttgatgctgagagtttaaatcctggagatcagatctttgagaagatcatttctggc
atgtatttaggggacattgtgcgcagagtattgtgcaagatggctgaagaagcttccttt
tttggtgatgttgtccccccaaaactgaaagttcccttcatactaaggactcctgacatg
tctgccatgcatcatgacacgtctccagatctaagagtggttgggagcaaactaaaggat
atcctggagatctccaacacctcgttgaaaatgagaaaggttgttgtggcgctatgcgac
atagttgccactcgtggggcccgcctctctgctgcagggatcatgggagtgctgaagaag
ttaggtagagacacagtaaaggagggagagaagcaaaagtcggttgtagcattggatggt
ggtttgtatgagcactacaccgaattccgaaccagcatggagagcactctcaaggagttg
ctgggtgatgaagttgctgagcacatttccgtcgagcactcaaacgatggctccggaatt
ggagctgccctcttggcagcctctcactcccagtaccttgaggtagaggagtcataa

DBGET integrated database retrieval system