KEGG   Prunus mume (Japanese apricot): 103341360Help
Entry
103341360         CDS       T03196                                 

Definition
(RefSeq) histone-lysine N-methyltransferase ASHH3
  KO
K11423  histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
pmum  Prunus mume (Japanese apricot)
Pathway
pmum00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:pmum00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    103341360
Enzymes [BR:pmum01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     103341360
Chromosome and associated proteins [BR:pmum03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     103341360
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET DUF682
Motif
Other DBs
NCBI-GeneID: 103341360
NCBI-ProteinID: XP_016651961
LinkDB All DBs
Position
LG8
AA seq 368 aa AA seqDB search
MPAMNKNSERSHIGNVFNKLLKQIGNPVDFELPDWFNKWKPMPYTFIKRNIYLTKKIKRR
LEDDGIFCSCSPSQGSSSVCGRDCHCGMLLSSCSSVCKCGSSCLNKPFQHRPVKKMKLVQ
TEKCGSGIVADEDIKQGEFVIEYVGEVIDDKTCEERLWNMKHRGETNFYLCEINRDMVID
ATYKGNKSRYINHSCCPNTEMQKWIIDGETRIGIFATRDVKKGEHLTYDYQFVQFGADQD
CHCGARDCRRKLGVRPTKPKMSSVAALKLVACQVAVSSPKLKAILSAKDVYQNGGLHIGN
SQPFHNQRGTRSCNCIGEVIRISRPTNQRSFGIIKRFDRYSKKHSIMFEDGGIEFLDMSK
EEWELVTL
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgcctgctatgaacaagaattctgagcgaagtcacattgggaacgtattcaacaagttg
ctgaagcagattggaaatcctgtagattttgaacttccagattggtttaataaatggaaa
ccgatgccctacacttttataaagcgcaatatatatctcacgaagaagattaaaagacga
cttgaggatgatggcatattctgttcctgcagcccatcacaagggtcttctagtgtttgc
ggtagagattgccattgtgggatgcttctgtctagctgctcctcagtctgtaaatgtgga
agttcctgtctgaacaaaccattccagcaccggcctgtgaagaagatgaaactggtgcag
actgagaaatgtggttctggaattgtggcggatgaagatattaagcaaggagaatttgtg
atagaatatgtgggagaagttattgatgacaaaacatgcgaggaaaggctatggaatatg
aaacaccgtggagaaacaaacttttacttatgtgaaatcaatcgagatatggttattgat
gccacatacaaaggaaacaagtcgagatatataaaccatagttgttgtcctaatactgag
atgcaaaaatggataatcgatggcgaaacaagaattggtatattcgcaactcgtgatgta
aaaaagggagaacacctgacctatgattatcagtttgttcaatttggtgcagatcaagat
tgccattgcggtgcacgtgattgtcggcgaaaacttggtgtcagacctaccaagccaaag
atgtcatcagttgctgctttgaaactagtagcatgtcaggtggctgtgtcctctcccaaa
ttgaaagcaattctttctgctaaagacgtttatcagaacgggggtctacatataggaaat
tcacaacctttccataaccaaagaggtacacgttcttgtaattgcattggtgaagtgatt
cgaataagtcgccccacgaatcagagatcctttgggattatcaagcggtttgatagatat
tccaaaaaacactcaatcatgtttgaagatggtggcatcgaattccttgacatgtcaaaa
gaagaatgggaacttgtaacactgtga

DBGET integrated database retrieval system