KEGG   Prunus mume (Japanese apricot): 103341467Help
Entry
103341467         CDS       T03196                                 

Definition
(RefSeq) dihydrolipoyllysine-residue acetyltransferase component 4 of pyruvate dehydrogenase complex, chloroplastic
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pmum  Prunus mume (Japanese apricot)
Pathway
pmum00010  Glycolysis / Gluconeogenesis
pmum00020  Citrate cycle (TCA cycle)
pmum00620  Pyruvate metabolism
pmum01100  Metabolic pathways
pmum01110  Biosynthesis of secondary metabolites
pmum01200  Carbon metabolism
Module
pmum_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pmum00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103341467
   00020 Citrate cycle (TCA cycle)
    103341467
   00620 Pyruvate metabolism
    103341467
Enzymes [BR:pmum01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     103341467
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl
Motif
Other DBs
NCBI-GeneID: 103341467
NCBI-ProteinID: XP_008243215
LinkDB All DBs
Position
Unknown
AA seq 466 aa AA seqDB search
MASSPFLSKTTISFSSSISTSLPWRSSHSSPSFSTAFRTKPRRRNLTVQSKIREIFMPAL
SSTMTEGKIVSWVKSEGDVLETFYDGILAAIVVGEGETAPVGSAIGLLAETEEEVAEAKA
KAKSASSDSPASSSPAAEAVTPTPPPATSTPAPAIAQPSPPATYTPKKTVATPFAKKLAK
QHKVDIASVVGSGPFGRITPADVEAAAGIAQPKKTVAAEPTPVSAAPPKPSAAPSASSAP
LLPGSTVVPFTTMQAAVSKNMLESLSVPTFRVGYPISTDALDALYEKVKPKGVTMTALLA
KAAALALAQHPVVNASCKDGKSFTYNSSINIAVAVAINGGLITPVLQDADKLDLYLLSQK
WKELVEKARAKQLQPHEYSSGTFTLSNLGMFGVDRFDAILPPGQGAIMAVGASKPTVVAD
ADGFFSVKSKMLVNVTADHRIVYGADLAAFLKTFAKIVENPESLTL
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcttctccatttctatcgaagaccaccatttccttctcctcctccatctccact
tctcttccttggcggtcctcacactcttccccttccttctccaccgcatttcgcactaaa
ccccgtcggagaaacctgaccgtccaatccaagatcagggagatcttcatgcctgccctc
agctccaccatgaccgagggaaagatcgtctcctgggtcaaatccgaaggcgacgtcctc
gagaccttctacgacggaattctcgctgccatcgtcgtcggcgaaggcgagaccgcccct
gtcggatccgccatcggactactggccgagaccgaagaggaagtcgctgaggctaaagcc
aaagccaaatccgcttcatcagattcccctgcttcttcttccccggctgctgaagctgtt
acgcccactcctcctcctgctacttccactcccgctccagcaatcgcccagccttctcca
cctgctacttacactcccaaaaagactgtggccacgccttttgccaaaaagctagccaag
caacacaaggtggacattgcctccgtggtgggctccggcccatttggccgaattacacct
gctgatgtggaggccgccgccggaattgcccagcccaagaaaaccgtcgccgccgagccc
actcccgtgtccgctgctccacccaagccttctgctgctccttcggcttcatcagcgcct
ctgcttcctggctcaaccgtggtgcccttcacaacgatgcaggccgccgtttcgaagaac
atgttggagagtctctcggtgccaacattccgcgttggttatccaatcagcaccgacgcg
ctcgatgccctctacgagaaggtgaagccaaagggtgtgaccatgactgcattgttggcc
aaggctgctgctctggcactcgctcagcacccggttgtaaatgccagctgcaaagacggg
aagagcttcacctataatagtagcataaacatcgctgttgctgtggcaatcaatggtggc
cttataacccctgttcttcaggatgccgacaagttggatttgtatttgttatcccagaaa
tggaaagagctagtggagaaggcccgtgcgaagcaacttcagccccatgagtacagttca
ggaactttcactttgtccaatttgggcatgtttggagtggacagatttgatgctattctt
cctccaggacagggggctatcatggctgttggagcttcaaagccaactgttgtggccgat
gcagatgggttcttcagtgtaaaaagtaaaatgctggtaaatgtaacagctgatcaccgg
attgtttatggtgctgatttggctgccttcctcaagacgtttgcaaagattgttgagaac
ccagagagcctcacgttgtag

DBGET integrated database retrieval system