KEGG   Prunus mume (Japanese apricot): 103343774
Entry
103343774         CDS       T03196                                 

Definition
(RefSeq) beta-glucosidase 12-like isoform X1
  KO
K13032  prunasin beta-glucosidase [EC:3.2.1.118]
Organism
pmum  Prunus mume (Japanese apricot)
Pathway
pmum00460  Cyanoamino acid metabolism
pmum01100  Metabolic pathways
pmum01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pmum00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    103343774
Enzymes [BR:pmum01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.118  prunasin beta-glucosidase
     103343774
SSDB
Motif
Pfam: Glyco_hydro_1
Other DBs
NCBI-GeneID: 103343774
NCBI-ProteinID: XP_008245634
LinkDB
Position
Unknown
AA seq 545 aa
MALQFRSLLLCVVLLLLGFALANTNAARTDPPIVCATLNRTHFDTLIPGFTFGAATAAYQ
LEGAANIDGRGPSVWDNFTHEHPEKITDGSNGDVAIDQYHRYKEDVAIMKDMGLDAYRFS
ISWSRLLPNGKLSGGINKKGIEYYNNLTNELLRNGIEPLVTLFHWDVPQALEDEYGGLLS
PHIVDDFKAYADLCYKEFGDRVKHWTTLNEPYTISNHGYTIGIHAPGRCSDWYNPNCLGG
DSGTEPYLVTHNLLLAHAAAVKLYREKYQACQNGVIGITVVSHWFEPASESQQDKDAAFQ
ALDFMYGWFMDPLTRGDYPQTMRSILGVRLPNFTEEQSKSLSGSYDYIGVNYYSARYARA
YPKDYSVPTPPSYLTDVHVNVTTADLNGVPIGPRAASDWLYVYPKGLYDLVLYTKEKYND
PIMYITENGMDEFNNPKLSLEQALDDANRIDYYYRHLCYLQAAIKEGANVQGYFAWSLLD
NFEWSEGYTVRFGINYIDYDNGLERHSKLSTHWFKSFLKRSSISKKKIRRCGNNNGRATK
FVYQI
NT seq 1638 nt   +upstreamnt  +downstreamnt
atggcattgcaattccgctctttgctcttgtgtgtggtgctgcttctccttggctttgca
ttggcaaataccaatgctgccaggacagatccacccattgtttgtgcaactctcaacagg
acccatttcgatactcttattccagggttcacatttggcgcagctacagcagcttaccaa
ttagaaggtgctgcaaacatagacggtagaggaccaagcgtatgggataacttcacccat
gagcatccagaaaagataactgatggtagcaatggagatgttgctattgatcaatatcac
cgttataaggaagatgtggcaattatgaaggatatggggttggatgcttataggttctct
atctcatggtccagattgttaccaaatggaaaactaagtggtggaattaacaagaaagga
atcgaatactacaataatctcaccaatgaactcctacgcaatggtatagagccattagtg
acactcttccactgggatgttccccaagccttagaagacgaatatggtggtttgttaagc
cctcatattgtcgatgactttaaagcatacgcagatctttgttataaggaatttggcgat
cgagtaaagcattggaccacacttaatgagccatataccattagtaaccatggttacaca
atcgggatccatgcaccaggacgatgctctgattggtataacccaaactgccttggtgga
gattcgggtactgaaccatatttggtgacacacaatctactccttgctcatgcagctgct
gtaaaattgtacagggaaaaatatcaggcatgtcaaaatggtgtcataggaataacagtt
gtatcacattggtttgagcccgcttcggagtcacaacaagataaagacgctgcatttcaa
gctttggattttatgtatggatggtttatggacccattgacaagaggtgactacccgcag
accatgcgatctattcttggtgtacggttaccgaattttacggaagaacaatccaagtca
ctgagtgggtcatatgactatattggagtaaactactactctgctagatatgcaagagct
tatcctaaggattattctgtacctacacctccaagctacctaacagatgttcatgttaat
gttacaacagctgatcttaatggggtccccattggtccacgggctgcttcagactggtta
tatgtttacccaaaaggactttacgatcttgtactctacacaaaggaaaagtataatgat
ccaattatgtacattactgagaatggcatggatgagttcaataatcccaaattatcactt
gagcaagcacttgatgatgctaatagaattgactactactatcgccacctctgttacctc
caagcagcaattaaggagggtgctaatgtgcagggatactttgcatggtctttgctagac
aactttgaatggagcgaaggatatactgttcgatttggtattaactatattgattacgac
aatggactggaaagacactcaaaactatcgacgcactggttcaaaagttttctcaagaga
tcctcaattagtaagaagaaaatccgaagatgtgggaacaataatggtagggctaccaaa
tttgtgtatcaaatttga

DBGET integrated database retrieval system