KEGG   Protobothrops mucrosquamatus (Taiwan habu): 107282543Help
Entry
107282543         CDS       T05763                                 

Gene name
DHDH
Definition
(RefSeq) trans-1,2-dihydrobenzene-1,2-diol dehydrogenase
  KO
K00078  dihydrodiol dehydrogenase / D-xylose 1-dehydrogenase (NADP) [EC:1.3.1.20 1.1.1.179]
Organism
pmur  Protobothrops mucrosquamatus (Taiwan habu)
Pathway
pmur00040  Pentose and glucuronate interconversions
pmur00980  Metabolism of xenobiotics by cytochrome P450
pmur01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmur00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    107282543 (DHDH)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    107282543 (DHDH)
Enzymes [BR:pmur01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.179  D-xylose 1-dehydrogenase (NADP+)
     107282543 (DHDH)
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.20  trans-1,2-dihydrobenzene-1,2-diol dehydrogenase
     107282543 (DHDH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GFO_IDH_MocA
Motif
Other DBs
NCBI-GeneID: 107282543
NCBI-ProteinID: XP_015665823
LinkDB All DBs
Position
Unknown
AA seq 334 aa AA seqDB search
MPLCWGICSAGKISHDFIVALKTLPADHKIAAIASSSLKRAQEYARLHGICRAYGSYEEL
AQDPDVDVIYVGSLNTQHLSHTTLFLRAKKHVLCEKPMGMNAREVREMIRTAQENDVFLM
EGFWTRFFPVSEKIRTVLGQKSLGNLKVLRAQLAFRMDNIPRLLEKKLGGGVILDLGSYC
IQFASMVFGPEMPQSVLASGLLYETGVDETVSIILNYSENRQAVLNVTMMIDLPGEATIG
GTEGIIKIPDNMNSPTIMFLNGNRWECPLPPSPEPLYFKHNIGFRYQIEHVRECLENGLK
ESPIMPLEESEKIACIMDEARKQVGVIYEQDRYV
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgcctctctgctggggaatctgctctgctgggaaaatttcccatgacttcattgtggcc
ttgaaaactctgccagcagatcacaagatagctgctatcgcttctagcagtctcaagcgt
gcccaggaatatgccagactacatggcatttgcagggcctatggctcttatgaggaactt
gcacaggatcctgatgtggatgtgatctacgtgggttctctcaacacccagcatctttct
cacaccaccctcttcctccgggctaaaaagcatgttctctgtgaaaaaccaatgggcatg
aatgcccgcgaagtacgggagatgatacgaacagctcaggagaacgacgtcttcctcatg
gagggcttctggaccagattcttcccggtgtctgaaaaaatccgtactgtcctgggccag
aaatctcttgggaatttaaaagtgctccgagctcaactagcttttcggatggacaatatt
ccaaggctgctggagaagaaactgggcggaggtgtcatcctggatttgggcagctactgc
atccagtttgcctctatggtttttggacctgaaatgccccagtcggttctggcctcagga
ttgctgtatgaaacaggagtggacgaaaccgtttccatcatcctcaactattcagagaac
cgtcaggctgtgcttaatgtcaccatgatgatcgatctgccaggagaggcaacgattgga
ggaacggaaggcatcatcaagattccggacaacatgaacagccctacaatcatgtttctg
aatgggaaccggtgggaatgtcccttgccgccttctccggagcccctctactttaagcac
aatattgggtttcgatatcaaattgaacacgtccgagagtgtctggaaaatggtttgaag
gaaagtcccatcatgcccttagaagagagtgaaaaaattgcctgtatcatggatgaagca
cgaaaacaggtgggagtaatctacgaacaggaccgttatgtgtag

DBGET integrated database retrieval system