KEGG   Protobothrops mucrosquamatus (Taiwan habu): 107282651
Entry
107282651         CDS       T05763                                 

Gene name
STAT3
Definition
(RefSeq) signal transducer and activator of transcription 3 isoform X1
  KO
K04692  signal transducer and activator of transcription 3
Organism
pmur  Protobothrops mucrosquamatus (Taiwan habu)
Pathway
pmur04068  FoxO signaling pathway
pmur04217  Necroptosis
pmur04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:pmur00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    107282651 (STAT3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    107282651 (STAT3)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    107282651 (STAT3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pmur03000]
    107282651 (STAT3)
Transcription factors [BR:pmur03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    107282651 (STAT3)
SSDB
Motif
Pfam: STAT_alpha STAT_bind STAT_int SH2 Baculo_PEP_C Syntaxin-6_N AP1AR Fib_alpha
Other DBs
NCBI-GeneID: 107282651
NCBI-ProteinID: XP_015665947
LinkDB
Position
Unknown
AA seq 772 aa
MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNL
LGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEENRLLQTAA
TAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLK
SQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRGIVSELAGLLSAMEYVQKTLVDEEL
ADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQ
HRPLLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNY
QLKIKVCIDKDSGEVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGN
GGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWY
NMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYS
GCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILST
KPPGTFLLRFSESSKEGGITFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIM
DATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHPEATDPGSAAPYLKTKFICVTPTTCS
STIELPMSPRTLESLIHFGSNGEGADGNASGQFESLQVFDMEMTAECANSPM
NT seq 2319 nt   +upstreamnt  +downstreamnt
atggcacagtggaatcaattgcagcaattggacacacgatacttggagcagctccaccag
ctttacagtgacagctttccaatggaacttcgtcagttccttgcaccttggatagagagc
caggattgggcttatgctgccagcaaagagtcccatgctacattggtatttcacaatctt
ctgggtgaaattgaccagcagtacagtcgcttcctacaagaatccaatgttctctatcag
cataatctacgccggatcaaacaattcctacagagcaggtatctggagaaacccatggag
attgcccgcattgtggcccgttgtctctgggaggagaatcgactgctacagacagcagca
acagcagcacagcaaggtgggcaggcaaaccatcctacagctgctgtagtgacagagaaa
cagcaaatgctggaacaacacttgcaagatgttagaaagcgtgtccaggatctggagcag
aaaatgaaagtggtggagaacctgcaggatgattttgattttaattataagactttgaag
agtcaaggtgatatgcaggatttgaatggaaacaaccagtcagtgacacgccagaagatg
caacagcttgagcaaatgctaactgcactggatcaaatgcgaagggggattgtgagtgaa
ctggctgggcttttatctgccatggaatatgtgcagaagacattggtggatgaggaactg
gctgattggaagaggagacagcagattgcatgtattggtggaccaccaaacatctgccta
gatcgtctggagaactggataacatccttggctgaatcacaacttcaaacacgtcagcag
attaagaaacttgaggagctgcagcagaaggtttcctacaagggggacccaattgttcaa
caccggccattgctggaagagcgcattgtggaattattcaggaatctcatgaagagtgct
tttgtggtagagcggcagccctgtatgccaatgcatccagaccgtccacttgttatcaaa
actggagtacaatttacaacaaaagtgcggttactggttaagtttcccgagctgaattat
cagctgaaaatcaaagtttgcattgacaaggattctggtgaagtggctgccctccgggga
tctcggaagtttaatatcttgggaacaaatactaaggtgatgaacatggaggaatccaac
aatggaagcctttctgcagagttcaagcatttgacactgagagagcagagatgtggcaat
ggtggaagagccaattgtgatgcctctctcattgtcacagaagaactccatcttattaca
tttgagacagaagtttaccaccaaggtttgaaaattgacttagagacccattcacttcca
gtagtggtgatctccaacatttgccagatgccaaatgcatgggcatccattttgtggtat
aacatgctgacaaacaatcccaagaacgtgaactttttcacaaagccacccattggcaca
tgggatcaagttgctgaggtgctcagctggcagttctcctcaaccaccaaacggggactc
agcatagaacagttgacaacccttgctgaaaagctacttggacctggtgtcaattactct
ggatgccaaataacatgggccaaattctgcaaggagaacatggcaggaaaagggttttca
ttctgggtctggctggacaatataattgacctggtgaagaagtacatcttggcactttgg
aatgaaggatatatcatgggcttcatcagcaaagagagggaaagagccatcctgagcaca
aaaccaccaggaacctttttgttgcgtttcagcgaaagcagtaaggaaggtggaatcact
ttcacatgggtggagaaggatattagtggaaaaacacaaattcaatcagtggagccgtac
accaagcaacaactcaataatatgtcatttgctgagattattatgggttacaagatcatg
gatgccaccaacatcctggtttccccacttgtttatttgtaccctgatattcctaaggaa
gaggcctttggaaaatactgccgtcctgagagccaggagcatcctgaagctactgaccca
ggtagcgctgctccgtatctgaagactaagtttatctgtgtaaccccaacaacttgcagt
agcactattgaactacccatgtctccccgcacacttgaatccctgatccattttggaagt
aatggtgaaggagctgatggaaatgccagtgggcaatttgagtccttgcaggtattcgac
atggagatgactgctgaatgtgccaattcacccatgtga

DBGET integrated database retrieval system