KEGG   Protobothrops mucrosquamatus (Taiwan habu): 107283118
Entry
107283118         CDS       T05763                                 

Gene name
KITLG
Definition
(RefSeq) kit ligand isoform X1
  KO
K05461  KIT ligand
Organism
pmur  Protobothrops mucrosquamatus (Taiwan habu)
Pathway
pmur04010  MAPK signaling pathway
pmur04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:pmur00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107283118 (KITLG)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    107283118 (KITLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pmur04052]
    107283118 (KITLG)
Cytokines and growth factors [BR:pmur04052]
 Growth factors
  Growth factors (RTK binding)
   107283118 (KITLG)
SSDB
Motif
Pfam: SCF Psg1
Other DBs
NCBI-GeneID: 107283118
NCBI-ProteinID: XP_015666456
LinkDB
Position
Unknown
AA seq 283 aa
MKKTQTWIITCFYLQLLLLYPLVKAQRPCGNPVTDDVNEIAILVGNLPDDYMIALRYVQK
TDTLPYHCWLHLMVPELLNSLNNLLNKFKEFPDMSNVLSNYSIINKLRRIIIDVMACLPS
TTYNKNYSQHDHLYEEDKFVPEEFFKHFYSTIEAYKNFSKRPEQSDCILPSTTEASPNDS
STSVTEPFLLHPVAASSLRNDSSGNNSNKAELDFLSKPSNQVLSIALSSLVAFVFGFVLG
AICWKKRTCRHILQIHQTTQSNINQEDNEISMLQHKDKSLLQV
NT seq 852 nt   +upstreamnt  +downstreamnt
atgaagaagacacaaacttggattatcacttgcttttatcttcaattgctcctactttat
cctcttgttaaagcccaacgtccctgtgggaatccggtgacagatgatgtaaatgaaatt
gcaatactggttggaaatcttccagatgattatatgatagctcttagatatgtccagaag
acggacacattgccttaccattgttggttgcatttgatggtccctgaattgttaaacagt
ctaaataatcttctcaataaatttaaagaatttccagatatgtcaaatgtcttgagtaat
tattcaattatcaataaactaaggaggatcatcattgatgtgatggcatgcttaccttct
accacatataataagaattatagccaacatgaccatctatatgaagaagataaatttgtt
ccagaagagttctttaagcacttttacagcactattgaggcctacaaaaacttttcaaaa
agaccagaacaaagtgactgcattcttccctcaacaacagaagcctctccaaatgattca
agcaccagtgtcacagagccatttttattacatcctgttgcagccagttcccttaggaat
gatagcagtggcaataacagcaacaaagcagaattggacttcctcagtaagcctagcaat
caagtattgagcatagcactttcatcattggtggcttttgtctttggctttgttttggga
gccatatgttggaagaaaaggacctgcaggcatatactacaaattcaccagactacacaa
tctaacatcaaccaagaagataatgagataagtatgttgcagcacaaagacaaatcgctt
ctacaagtgtag

DBGET integrated database retrieval system