KEGG   Protobothrops mucrosquamatus (Taiwan habu): 107283236
Entry
107283236         CDS       T05763                                 

Gene name
TGFA
Definition
(RefSeq) protransforming growth factor alpha
  KO
K08774  transforming growth factor, alpha
Organism
pmur  Protobothrops mucrosquamatus (Taiwan habu)
Pathway
pmur04010  MAPK signaling pathway
pmur04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:pmur00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107283236 (TGFA)
   04012 ErbB signaling pathway
    107283236 (TGFA)
SSDB
Motif
Pfam: EGF_2 EGF hEGF
Other DBs
NCBI-GeneID: 107283236
NCBI-ProteinID: XP_015666595
LinkDB
Position
Unknown
AA seq 183 aa
MASAAAEVALLTLAPIGACHVVEDAQYGDLPYRRPPNSVLLAVCHALENTTSALRGPPVA
AAVRSHFNNCPDAHSTFCFHGTCRFLVQEEEPTCVCHSGYMGARCEHADLLAVVAAAQKK
QTITALVVVSIVASIVVIMVCVLIHCCRIRKPCEWCRTIVCRHEKPTGLLKGATSCCHSE
TVV
NT seq 552 nt   +upstreamnt  +downstreamnt
atggccagcgcggccgccgaggtcgccctgctcacgctcgctcccattggtgcttgccat
gtggtggaggatgcccaatacggagatcttccctatagaagacctccaaacagtgttttg
ttggcggtgtgccatgccttagagaacacaacatcagccttgaggggtcccccggtggca
gctgcagtgaggtcccattttaacaactgtccagatgcccacagtacattttgtttccac
gggacttgcagattcctggtgcaagaagaagaacctacttgtgtgtgccattctggctac
atgggtgcccgctgcgagcatgccgatctcctggcagtggtggctgccgcccagaagaaa
caaaccataaccgccttggtggtggtttccatcgtcgcctccattgtcgttatcatggtc
tgtgtcctgatacattgctgcaggatacggaagccctgcgagtggtgtaggacgatcgtc
tgcaggcatgagaaacccaccgggctcctgaagggggccacgtcttgctgccactcagag
acagttgtctga

DBGET integrated database retrieval system