KEGG   Protobothrops mucrosquamatus (Taiwan habu): 107283682Help
Entry
107283682         CDS       T05763                                 

Gene name
RPA3
Definition
(RefSeq) replication protein A 14 kDa subunit
  KO
K10740  replication factor A3
Organism
pmur  Protobothrops mucrosquamatus (Taiwan habu)
Pathway
pmur03030  DNA replication
pmur03420  Nucleotide excision repair
pmur03430  Mismatch repair
pmur03440  Homologous recombination
pmur03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:pmur00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    107283682 (RPA3)
   03420 Nucleotide excision repair
    107283682 (RPA3)
   03430 Mismatch repair
    107283682 (RPA3)
   03440 Homologous recombination
    107283682 (RPA3)
   03460 Fanconi anemia pathway
    107283682 (RPA3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:pmur03032]
    107283682 (RPA3)
   03400 DNA repair and recombination proteins [BR:pmur03400]
    107283682 (RPA3)
DNA replication proteins [BR:pmur03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    107283682 (RPA3)
DNA repair and recombination proteins [BR:pmur03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     107283682 (RPA3)
   MMR (mismatch excision repair)
     107283682 (RPA3)
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     107283682 (RPA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rep_fac-A_3
Motif
Other DBs
NCBI-GeneID: 107283682
NCBI-ProteinID: XP_015667101
LinkDB All DBs
Position
Unknown
AA seq 119 aa AA seqDB search
MADILEGPRVRVSASQLSQYVGKLVCFVGRLEKIHQSGKFFFLSDGEGKNAAIELNTPLE
EEISGVIEVVGRVTNQLNIMCSSYMQFKEDKNMFDLSMYSEAVKVIHEFPEYYPFSTDV
NT seq 360 nt NT seq  +upstreamnt  +downstreamnt
atggccgatatattagagggtccccgcgttcgtgtcagcgcaagtcaactgtcgcaatac
gttggaaagcttgtctgtttcgtgggacgccttgaaaagatccatcaatctgggaaattc
ttctttctatctgatggagaaggaaaaaatgcagcaattgagctaaatacacctcttgaa
gaagagatttctggcgttattgaagtagtaggaagagttacaaatcaactgaatatcatg
tgttcatcatatatgcaattcaaagaagataaaaacatgtttgatctttcaatgtacagt
gaggctgtaaaagttatccatgagtttcctgagtactaccctttcagtactgatgtatga

KEGG   Protobothrops mucrosquamatus (Taiwan habu): 107288015Help
Entry
107288015         CDS       T05763                                 

Gene name
RPA2
Definition
(RefSeq) replication protein A 32 kDa subunit
  KO
K10739  replication factor A2
Organism
pmur  Protobothrops mucrosquamatus (Taiwan habu)
Pathway
pmur03030  DNA replication
pmur03420  Nucleotide excision repair
pmur03430  Mismatch repair
pmur03440  Homologous recombination
pmur03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:pmur00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    107288015 (RPA2)
   03420 Nucleotide excision repair
    107288015 (RPA2)
   03430 Mismatch repair
    107288015 (RPA2)
   03440 Homologous recombination
    107288015 (RPA2)
   03460 Fanconi anemia pathway
    107288015 (RPA2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:pmur03032]
    107288015 (RPA2)
   03400 DNA repair and recombination proteins [BR:pmur03400]
    107288015 (RPA2)
DNA replication proteins [BR:pmur03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    107288015 (RPA2)
DNA repair and recombination proteins [BR:pmur03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     107288015 (RPA2)
   MMR (mismatch excision repair)
     107288015 (RPA2)
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     107288015 (RPA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RPA_C tRNA_anti-codon LexA_DNA_bind
Motif
Other DBs
NCBI-GeneID: 107288015
NCBI-ProteinID: XP_015672076
LinkDB All DBs
Position
Unknown
AA seq 266 aa AA seqDB search
MWSGHGGYDSNYGNYTQSPGGFTSPSATQGERKSRSRSQNIVPCTVSQLFSAEQVDDVFR
VREVELSQVIIVGIIRHAEKAPTNILYKVDDMTAAPMDVRQWVDTDEEGSENVVVPPGTY
VKVAGHLRSFQNKKSLVAFKIMPLEDMNEFTTHLLEVVNAHMTLRKSNTPQSSKIPQSFG
VFETSSMSNARGNDSLTMHGLTPHQSQVLNLIKSCMTTEGISLHDLKSQLHNINLQTLKK
AVEFLSSEGHIYSTIDDEHFKSTDAD
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgtggtctggtcacggaggttatgacagcaattatggcaactatacacaatcacctgga
ggatttacatcgccttctgcaacccaaggcgaaagaaaatcaaggtcaaggtcacagaac
attgttccctgtacagtatcacaactattttcagctgaacaagtggatgatgttttcagg
gtccgtgaagttgaactttcacaggttattattgtgggcataatcaggcatgctgaaaaa
gctccaacaaatattctctacaaagtggatgacatgactgcagccccaatggatgtgagg
cagtgggtcgacactgatgaggagggcagtgaaaatgtggttgttccaccaggaacctac
gtgaaagtagctggtcatctgcgatctttccagaacaaaaagagcctggttgcattcaag
attatgcccctggaagatatgaatgaatttactacacatctgcttgaagttgtcaacgca
cacatgaccctcagaaaaagtaacacgccccaatcttcaaagatacctcagtcctttggt
gtatttgagacgagcagtatgtcaaatgccagaggaaatgattccttgacaatgcatggt
cttacaccacaccagagtcaggttctgaatttgattaaaagctgcatgacaactgaagga
ataagtcttcatgatctgaaatctcagttgcataatattaatctacaaacgctcaagaaa
gctgttgagtttcttagcagtgagggacatatatactccactattgatgatgaacatttc
aagtctacagatgctgactaa

KEGG   Protobothrops mucrosquamatus (Taiwan habu): 107296194Help
Entry
107296194         CDS       T05763                                 

Gene name
RPA1
Definition
(RefSeq) replication protein A 70 kDa DNA-binding subunit
  KO
K07466  replication factor A1
Organism
pmur  Protobothrops mucrosquamatus (Taiwan habu)
Pathway
pmur03030  DNA replication
pmur03420  Nucleotide excision repair
pmur03430  Mismatch repair
pmur03440  Homologous recombination
pmur03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:pmur00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    107296194 (RPA1)
   03420 Nucleotide excision repair
    107296194 (RPA1)
   03430 Mismatch repair
    107296194 (RPA1)
   03440 Homologous recombination
    107296194 (RPA1)
   03460 Fanconi anemia pathway
    107296194 (RPA1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pmur03000]
    107296194 (RPA1)
   03032 DNA replication proteins [BR:pmur03032]
    107296194 (RPA1)
   03400 DNA repair and recombination proteins [BR:pmur03400]
    107296194 (RPA1)
Transcription factors [BR:pmur03000]
 Eukaryotic Type
  Zinc finger
   Other Cys4 zinc finger factors
    107296194 (RPA1)
DNA replication proteins [BR:pmur03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    107296194 (RPA1)
DNA repair and recombination proteins [BR:pmur03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     107296194 (RPA1)
   MMR (mismatch excision repair)
     107296194 (RPA1)
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     107296194 (RPA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rep_fac-A_C REPA_OB_2 Rep-A_N tRNA_anti-codon DUF223
Motif
Other DBs
NCBI-GeneID: 107296194
NCBI-ProteinID: XP_015681029
LinkDB All DBs
Position
Unknown
AA seq 620 aa AA seqDB search
MASVAAAAAAGLSEGAIAAILLQAEPVGRPVLQLITIRPISTGNGPPRYRMLMSDGVNTL
SSFMLATQLNPLVDDQSLTANAICQINRFIVNTLKDGRRVVVLMEMEVLQPGHAVPAKIG
NPVPYVEAGRQPAAPSPATGPFQSKPVGLQSGAPDAGAQYPSSSRLLGNAGGSGILSTPG
GSQVKVVPIASLNPYQSKWTICARVTQKGQIRTWSNSRGEGKLFSIEMVDESGEIRATAF
NDQADKFFPIIEMNKVYYFSKGTLKTANKQYSSVKNDYEIAFSNETSVVPCEDAQHLPSV
QFDFVAIGDLENTNKDSLVDVIGVCKSYDDPQKITIKASNREVSKRELHLMDMSGKTVTV
TLWGADAEKFDGSRQPVVAIRGARVSDFGGRSLSVVSSSSLLVNPDCPEAFKLRGWFDSE
GQHLESASISSGRGGLMPGGNTNWKTLQESKAENLGQGDKADYFSCVGTVVYLRKENCMY
QACPSQDCNKKVIDEHNGLFRCEKCDREFPNFKYRMILSANIADFQDNQWVTCFQESAEA
ILGHNTAYLGELKEKNEHAFDEVIQNANFTSHEFRIRVKLETFNDESRLKATAMEVKPVN
YQEYCKRLILNIRKNAAQLG
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcggtggcggcggcggcggcggcggggctgagcgagggggccatcgcggccata
ctgctgcaggcggagccggtggggaggccggtgctgcagctgatcacgatccgccccatc
tccacggggaacggccccccacgctaccggatgctgatgagcgatggtgtgaacaccctt
tcctctttcatgctggccacgcagctgaaccctctggtggatgaccagagcttgaccgca
aatgccatttgccagattaaccgcttcattgtgaacactctgaaggatggaaggcgagtg
gtggtcttgatggaaatggaggttctgcagccgggtcacgccgtccccgccaagatcgga
aacccagtcccgtacgttgaagcagggaggcagcccgcggcccccagcccagcaaccggc
cctttccagagcaagccagtggggctccagagcggggctccagatgcaggggcacagtac
cccagctcttccagactgctggggaacgcagggggctccggcatcctgagcactccgggg
ggatctcaggtcaaagtggtgcccatcgccagcttgaacccttaccagtccaagtggacc
atctgtgcccgggtgacccagaagggccagatccgcacctggagcaactcccggggcgaa
gggaagctcttctccatagagatggtggatgagagcggtgagatccgagcgacggccttc
aacgaccaagcggacaagtttttccctatcatcgagatgaacaaggtctactacttctcc
aagggcaccctgaagacggccaacaagcagtattcgtctgtgaagaacgactacgagatc
gccttctccaacgagacgtccgtcgttccctgcgaggacgcccagcaccttccctccgtg
cagtttgacttcgtggccatcggggacttggaaaacacaaacaaggactccctcgtggac
gtgatcggggtctgcaagagctacgacgaccctcaaaagatcaccatcaaggcttccaat
cgggaggtctccaagagagaactgcacctgatggacatgtcgggcaagacagtgacggtc
actctctggggcgcggacgcggaaaagtttgacggctctcggcagccggtagtggccatc
cggggggcccgggtctcggacttcgggggccggagcctctccgtggtctcctccagcagc
ctcctggtgaaccccgactgcccggaggccttcaagctgcgaggctggtttgattcggaa
gggcagcacctggagtccgcctccatctcttctgggcggggcgggctgatgccagggggg
aacaccaactggaagaccctgcaggagtccaaggcggagaacctgggccaaggagacaag
gccgactacttcagctgcgtgggcacggtggtgtacctgcgcaaggagaactgcatgtac
caagcctgcccctcccaggactgcaacaagaaggtgattgacgagcacaatggcctcttc
cgctgcgagaagtgcgaccgggagttccccaacttcaagtaccgcatgatcctgtcggcg
aacattgcagacttccaggacaatcagtgggtgacctgcttccaggagtctgcggaggcc
atcctggggcacaacacggcttacctgggggagctgaaggagaagaacgagcacgctttc
gacgaggtcatccagaacgccaacttcacctcccacgaattccggatccgagtcaagctg
gagacgttcaatgatgagtcgcgcctgaaggccacggccatggaggtgaagcccgtcaac
taccaggagtactgcaagaggctgatcctgaacatccgcaagaacgctgcccagctgggc
taa

KEGG   Protobothrops mucrosquamatus (Taiwan habu): 107300767Help
Entry
107300767         CDS       T05763                                 

Definition
(RefSeq) replication protein A 70 kDa DNA-binding subunit-like
  KO
K07466  replication factor A1
Organism
pmur  Protobothrops mucrosquamatus (Taiwan habu)
Pathway
pmur03030  DNA replication
pmur03420  Nucleotide excision repair
pmur03430  Mismatch repair
pmur03440  Homologous recombination
pmur03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:pmur00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    107300767
   03420 Nucleotide excision repair
    107300767
   03430 Mismatch repair
    107300767
   03440 Homologous recombination
    107300767
   03460 Fanconi anemia pathway
    107300767
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pmur03000]
    107300767
   03032 DNA replication proteins [BR:pmur03032]
    107300767
   03400 DNA repair and recombination proteins [BR:pmur03400]
    107300767
Transcription factors [BR:pmur03000]
 Eukaryotic Type
  Zinc finger
   Other Cys4 zinc finger factors
    107300767
DNA replication proteins [BR:pmur03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    107300767
DNA repair and recombination proteins [BR:pmur03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     107300767
   MMR (mismatch excision repair)
     107300767
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     107300767
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: REPA_OB_2 tRNA_anti-codon DUF223 Rep_fac-A_C Spo7_2_N
Motif
Other DBs
NCBI-GeneID: 107300767
NCBI-ProteinID: XP_015685544
LinkDB All DBs
Position
Unknown
AA seq 379 aa AA seqDB search
MYLGALLASGALSGSLNVLSSAPCSAHREFILLGPLPPSWAASERSSIRMLAKATFRRVV
VLMEMEVLQPGHAVPAKIGNPVPYVEGAGQAGRQPTAPSPATGPFQSKPVGLQSGAPDAG
AQYPGSSRLLGNAGGSGILSTPGGSQVKVVPIASLNPYQSKWTICARVTQKGQIRTWSNS
RGEGKLFSIEMVDESGEIRATAFNDQADKFFPIIEMNKVYYFSKGTLKTANKQYSSVKND
YEIAFSNETSVVPCEDAQHLPSVQFDFVAIGDLENTNKDSLVDVIGVCKSYDDPQKITIK
ASNREVSKRELHLMDMSGKTVTVTLWGADAEKFDGSRQPVVAIRGARVSDFGGRSLSVVS
SSSLLVNPDCPEAFKLRGW
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgtatctgggagccctcctggcctccggggccctttcgggcagcttgaacgttctgagt
tctgccccctgcagcgcccaccgggagttcatcctgcttggccctttgcctccgtcctgg
gctgcctctgagcggagcagcatccggatgctggcaaaagctaccttcaggcgagtggtg
gtcttgatggaaatggaggttctgcagccgggtcacgccgtccccgccaagattggaaac
ccagtcccgtacgttgaaggagctgggcaagcagggaggcagcccacggcccccagccca
gcaaccggccctttccagagcaagccagtggggctccagagcggggctccagatgcaggg
gcacagtaccccggctcttccagactgctggggaacgcagggggctctggcatcctgagc
actccggggggatctcaggtcaaagtggtgcccatcgccagcttgaacccttaccagtcc
aagtggaccatctgtgcccgggtgacccagaagggccagatccgcacctggagcaactcc
cggggggaagggaagctcttctccatagagatggtggatgagagcggtgagatccgagcg
acggccttcaacgaccaagcggacaagtttttccctatcatcgagatgaacaaggtctac
tacttctccaagggcaccctgaagacggccaacaagcagtattcgtctgtgaagaacgac
tacgagatcgccttctccaacgagacgtccgtcgttccctgcgaggacgcccagcacctg
ccctccgtgcagtttgacttcgtggccatcggggacttggaaaacacaaacaaggactcc
ctcgtggacgtgatcggggtctgcaagagctatgacgaccctcaaaagatcaccatcaag
gcttccaatcgggaggtctccaagagagaactgcacctgatggacatgtcgggcaagaca
gtgacagtcactctctggggtgcggacgcggaaaagttcgacggctctcggcagccggta
gtggccatccggggggcccgagtctcggacttcgggggccggagcctctccgtggtctcc
tccagcagcctcctggtgaaccccgactgcccggaggccttcaagctgcgaggctggtga

DBGET integrated database retrieval system