KEGG   Protobothrops mucrosquamatus (Taiwan habu): 107283952Help
Entry
107283952         CDS       T05763                                 

Gene name
PFKP
Definition
(RefSeq) ATP-dependent 6-phosphofructokinase, platelet type isoform X1
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pmur  Protobothrops mucrosquamatus (Taiwan habu)
Pathway
pmur00010  Glycolysis / Gluconeogenesis
pmur00030  Pentose phosphate pathway
pmur00051  Fructose and mannose metabolism
pmur00052  Galactose metabolism
pmur01100  Metabolic pathways
pmur01200  Carbon metabolism
pmur01230  Biosynthesis of amino acids
pmur03018  RNA degradation
Module
pmur_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pmur00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107283952 (PFKP)
   00030 Pentose phosphate pathway
    107283952 (PFKP)
   00051 Fructose and mannose metabolism
    107283952 (PFKP)
   00052 Galactose metabolism
    107283952 (PFKP)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    107283952 (PFKP)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pmur01009]
    107283952 (PFKP)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pmur03019]
    107283952 (PFKP)
Enzymes [BR:pmur01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     107283952 (PFKP)
Protein phosphatases and associated proteins [BR:pmur01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     107283952 (PFKP)
Messenger RNA biogenesis [BR:pmur03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     107283952 (PFKP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 107283952
NCBI-ProteinID: XP_015667426
LinkDB All DBs
Position
Unknown
AA seq 752 aa AA seqDB search
MNAAVRAVVRMGIYVEAKVYFVYEGYQGMVDGGENIVEVTWESVSSILQVGGTVIGSARC
KAFRTREGRLKAACNLVKRGITNLCVIGGDGSLTGANLFRGEWNGLLEELARNGEIEEEA
VKNYAYLNIVGMVGSIDNDFCGTDMTIGTDSALHRIIEVVDAIMTTAQSHQRTFVLEVMG
RHCGYLALVSALACGADYVFIPEYPPEEGWEDHMCARLSENRARKKRLNIIIVSEGAIDS
FNKAITSEQVKDLVVKRLGFDTRVTILGHVQRGGTPSAFDRILASRMGVEAVLALLEATP
ETPACVVTLSGNQAVRLPLMECVQMTQDVQKAMDERRFKDAVELRGRSFTNNLNTYKLLS
NKKPEDELPKSNFTVAILNVGAPAAGMNAAVRSAVRLGITEGHKMLAVTDGFEGFSRGQI
KEIKWGDVGGWTGQGGSILGTKRTLPGKYLEKIAEHMRAHNINALLVIGGFEAYLGLLEL
SSAREKYEAFCIPMVMVPATVSNNVPGSDFSIGADTALNTITNTCDRIKLSASGTKRRVF
IIETMGGYCGYLANMGALAAGADAAYIFEEKFDIRELQANVEHLTQKMKTNIQRGLVLRN
ENSSENYTTDFIYQLYSEEGKGVFDCRKNVLGHMQQGGAPSPFDRNFGTKIAAKAVLWIS
KQLKQSYRREEGKVFANTPETVCLLGMRKRNLDFQPVIKLQDESDFVHRIAKEQWWLKLR
PLMKILAKYKASYDISDSGQLEHVVRPTASEA
NT seq 2259 nt NT seq  +upstreamnt  +downstreamnt
atgaatgccgcagtccgtgcagtggtgcgcatggggatctatgttgaagcgaaagtgtat
tttgtctatgagggataccaaggtatggttgatgggggtgaaaatattgttgaagttaca
tgggagagtgtttcaagtatcctccaagtggggggaactgttattggcagcgctcgctgt
aaagcttttcggactcgcgaaggccgtttgaaagcagcctgcaatctggtgaagcgagga
atcacaaacctttgtgtgattgggggagatggcagcttaaccggtgctaatctctttcgg
ggagagtggaatggcctgttagaggagttggcaagaaatggtgagattgaagaagaagct
gtaaagaactatgcttacctcaacatagtgggaatggttgggtccattgacaatgatttc
tgtgggacagacatgactattggcacagattctgccctgcatagaatcattgaagttgtg
gatgccatcatgactactgctcaaagccatcagaggaccttcgtcctagaagtgatggga
agacactgtgggtatctggcacttgttagtgctttagcctgcggtgcagactatgtattt
atccctgaatatccacctgaggaaggatgggaagatcatatgtgtgctaggctttctgag
aaccgtgcccgaaagaaaaggttgaatattataattgtgtcagaaggagcaattgattcc
ttcaacaaggctatcacttctgaacaagttaaggatcttgtagtgaagcggttggggttt
gacacacgggtaaccattcttggccatgtgcaacgaggaggcacaccctctgcttttgat
cggattttggccagccgtatgggagtagaggctgtccttgctcttctggaagccacccct
gaaacacctgcttgtgtggtgaccttatccgggaaccaggctgtccgtctgcctttaatg
gagtgtgttcaaatgactcaagatgttcagaaagctatggatgaaagaagattcaaagat
gcagtagaactccgcggaaggagttttaccaacaacttgaatacctacaagctcctgtct
aacaaaaagccagaagacgaactacctaagagcaattttactgtcgctatcctaaatgtg
ggtgctccagcggctgggatgaatgctgctgtccgttctgcagtgagacttggaatcact
gaaggacacaaaatgttagctgttactgatggctttgaaggcttttctagagggcagatt
aaagaaatcaagtggggagatgttggaggttggactggccaaggagggtcaatacttggc
accaaacgtacactccctggaaagtatttggagaagattgcagaacacatgcgtgctcat
aacatcaatgccctccttgtcattggtggctttgaggcatacctgggactcttggagctt
tcttcagcccgggagaaatatgaagcgttctgtatccccatggttatggttcctgcaacc
gtatccaacaatgtacctggttctgatttcagcattggtgcagatactgctctgaacact
atcactaatacctgtgaccgaatcaagctatcggcaagtgggacgaaacgacgcgtgttc
atcattgagaccatgggaggctactgtggctacttggctaacatgggggctttggctgca
ggtgcagatgctgcatatatttttgaagaaaaatttgacattcgggagctacaggccaat
gtggaacatctcacccaaaagatgaaaactaacatccagagaggtttggtactcaggaat
gaaaatagtagcgagaactacacaactgacttcatttatcagctctattcggaagaaggc
aaaggggtctttgattgtcgaaagaatgtgctgggtcatatgcagcagggtggtgctcct
tctccatttgatagaaactttgggacaaaaatagcggcaaaagctgtgctgtggatctca
aagcaactgaaacaaagctaccgaagagaagaaggaaaggtgtttgccaatactccagaa
actgtgtgccttctaggaatgcgtaagagaaacttggacttccagccggtgatcaagtta
caggatgaatcagactttgtgcaccgaattgctaaggaacagtggtggctaaaattgcgt
cctctgatgaagatcctggccaaatacaaggccagctatgatatttctgattcaggccag
ctagagcacgtggtgagaccaacggcatctgaagcctga

DBGET integrated database retrieval system