KEGG   Protobothrops mucrosquamatus (Taiwan habu): 107284206
Entry
107284206         CDS       T05763                                 

Gene name
IKBKG
Definition
(RefSeq) NF-kappa-B essential modulator
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
pmur  Protobothrops mucrosquamatus (Taiwan habu)
Pathway
pmur04010  MAPK signaling pathway
pmur04210  Apoptosis
pmur04620  Toll-like receptor signaling pathway
pmur04621  NOD-like receptor signaling pathway
pmur04622  RIG-I-like receptor signaling pathway
pmur04623  Cytosolic DNA-sensing pathway
pmur04625  C-type lectin receptor signaling pathway
pmur04920  Adipocytokine signaling pathway
pmur05132  Salmonella infection
pmur05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pmur00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107284206 (IKBKG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    107284206 (IKBKG)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107284206 (IKBKG)
   04621 NOD-like receptor signaling pathway
    107284206 (IKBKG)
   04622 RIG-I-like receptor signaling pathway
    107284206 (IKBKG)
   04623 Cytosolic DNA-sensing pathway
    107284206 (IKBKG)
   04625 C-type lectin receptor signaling pathway
    107284206 (IKBKG)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    107284206 (IKBKG)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107284206 (IKBKG)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    107284206 (IKBKG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pmur01001]
    107284206 (IKBKG)
Protein kinases [BR:pmur01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   107284206 (IKBKG)
SSDB
Motif
Pfam: CC2-LZ NEMO zf_C2H2_10 Spidroin_N BT1
Other DBs
NCBI-GeneID: 107284206
NCBI-ProteinID: XP_015667712
LinkDB
Position
Unknown
AA seq 587 aa
MSITQGDWSCNMVQPSGCPAGDYGMMGDDSSLGKAGTLQLPAELAGHETVQYFLAENRDL
KEAIRQSNHMLRERYQEFVQFHASKKEEKEFIMSKFQEARLVVENLHMERMGLEKQLQQA
FQDLERLKTASRPFLSEKDPSDTQEESDTVTLTEEDVLTVTSGLLKQKKERLEEDWKALQ
DTNQALQKEKLALEAKIAILQQTEKVTLPVEEFRIKIKENGCSLEQSLEVESLQSSGDNA
GEKQIEQLQQRLKEAEDESLAFRQQLASSLEELACRTAQEQKIQQQLQTLTKQLEQVGED
KTLAKAQVTSLLGELLESQSRLETCTEQNKELEARVRGAGERLQQLEKEAEIRNKQHGVQ
VDQLRLQVQNLESALRVERQSATEEKRKLAQVQVAYHQLFQEYDAHIKTSLETEKRSKGL
DLQLAELSQQLQQAEEALVAKQEYIDKLKEEAEQHKTVMETVPVLKAQADIYKTDFLAER
QAREKLHEQRETLLEQVAQLQRENEKLKADSEGVSRALMEEMRNRHSEMRPPPQPTFMMG
TAPFHPQLVTGRRQNVLEEQPIHYCPKCQYKAPDMDTLQIHVMDCIQ
NT seq 1764 nt   +upstreamnt  +downstreamnt
atgagtataacccaaggggattggagctgcaacatggtgcagccaagtgggtgcccagct
ggtgactatggcatgatgggagatgattcctccctgggcaaagctggtacccttcagttg
ccagctgagctagcaggacatgaaactgtacaatatttcctggctgagaatagagacctc
aaagaagccatccggcagagtaatcacatgctacgagagcggtaccaggaatttgtgcag
ttccatgcttccaaaaaggaggagaaagaattcattatgagcaagtttcaggaggctcgg
cttgtggtggaaaacttgcacatggaacgcatggggttggaaaaacagttgcagcaggct
tttcaggatctggagcgactaaagacagcttctcgaccatttctctcagaaaaagacccc
tctgacacacaagaggagtcagatactgtgactcttactgaggaagatgtacttactgtg
acatcggggcttctaaaacagaaaaaagaaaggctggaagaggactggaaagcactgcaa
gacaccaaccaggccttacagaaagaaaaacttgccttggaggctaagatcgccatactg
caacaaacagaaaaggtcactttgccggtagaggagttcagaataaagattaaagagaat
ggttgttcattggagcagtcccttgaagtagagtccttgcagagctcgggggacaatgcg
ggtgagaaacaaattgagcagctgcaacaaaggctgaaggaggctgaagatgaaagctta
gcctttcggcaacagctggcatccagtttggaggagctagcctgccggactgcccaggag
cagaagatccagcagcagctacaaaccttgaccaaacaactggagcaagttggggaggac
aagactttagcaaaggcccaggtgacatctctgctgggggagctgctggagagccagagc
cgcctcgaaacttgtacagagcaaaacaaagagctggaggcaagggttcgtggggctggt
gaacgactgcagcagcttgaaaaggaggctgaaatccgcaacaagcagcacggcgtacag
gtggatcagttgaggttgcaggtgcaaaaccttgagagtgctctgcgagtggaacgacag
agtgccaccgaggaaaagagaaaattggcccaagtgcaagtggcctatcaccagctcttc
caggagtacgatgcccacatcaaaaccagcttggaaactgagaagcgaagcaagggcttg
gatctgcagcttgctgaactgtctcagcaactgcagcaggctgaggaggctctggtagcc
aagcaagagtacattgacaagctgaaggaggaagctgagcagcacaaaactgtcatggag
actgtgcctgtgctcaaggcccaggctgatatctacaagacagatttcctggcagagcgc
caggcacgtgaaaagctacacgaacaacgagagaccctgctggagcaggttgcccagttg
caaagggaaaatgagaagctgaaagccgactctgaaggagtcagccgggctctgatggaa
gagatgaggaatcgccattcagaaatgcgtccgcctcctcagccgactttcatgatgggc
actgctccattccatccccagcttgtaacagggcgaagacaaaatgttctagaagaacag
cctatccattattgtcccaaatgccagtataaagctccagacatggacaccctacagatc
catgtcatggattgtatccagtaa

DBGET integrated database retrieval system