KEGG   Protobothrops mucrosquamatus (Taiwan habu): 107284375Help
Entry
107284375         CDS       T05763                                 

Gene name
GADL1
Definition
(RefSeq) acidic amino acid decarboxylase GADL1
  KO
K18966  sulfinoalanine decarboxylase / aspartate 1-decarboxylase [EC:4.1.1.29 4.1.1.11]
Organism
pmur  Protobothrops mucrosquamatus (Taiwan habu)
Pathway
pmur00410  beta-Alanine metabolism
pmur00430  Taurine and hypotaurine metabolism
pmur00770  Pantothenate and CoA biosynthesis
pmur01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmur00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    107284375 (GADL1)
   00430 Taurine and hypotaurine metabolism
    107284375 (GADL1)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    107284375 (GADL1)
Enzymes [BR:pmur01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.11  aspartate 1-decarboxylase
     107284375 (GADL1)
    4.1.1.29  sulfinoalanine decarboxylase
     107284375 (GADL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 SepSecS Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 107284375
NCBI-ProteinID: XP_015667906
LinkDB All DBs
Position
Unknown
AA seq 707 aa AA seqDB search
MGQIHFQFETKCGTDPLEIPREQSCPGNGLASGLLNQMKLTGSLELLTQLPAILSLLVLK
ASRMIIYRWVQEVINASVKNEVFPALFKEALVHPLLKKSSSDPSCVDNLSNFPSFLSSKD
GGKSGCVAVQMVLDEKDYLDPFQLGFRPRYRTEMVLVMLVDDICIMWLVLVCLNAKVPEH
FSFFIAAYFKTFWVLTAYLEMNNQLEKSQKNNAILVDGVILNGPAADSKSGEKFVEEVSK
IIMEEVVKKASDATEKVCEWQSPEKLRTLLDLELKDTGESHPKLLQLCQDVIQFSVKTYH
PRFFNQLYAGIDYYSLAARFIMEALNPSVYTYEISPVFLLVEEAVLKKMIEYIGWEGGDG
IFNPGGSVSNMYAMNLARYKYFPDIKEKGLSGIPQLVLFTSEECHYSVKKAASFLGIGTQ
NVYFVKSDDRGKMIPEELEKQVQRARNEGSAPFFVSATAGTTVLGAFDPLNEIADICEKY
NLWLHVDASWGGSALLSRKHRKLLHGIHRATSVAWNPHKMLMAGIQCCALLVKDNSDLLK
RCYSANASYLFQQDKFYDISYDTGDKSIQCSRRADAFKFWMTWKAMGTTGLEERVNRALA
LVRYLVDEIKKREGFQLLLEPEYANICFWYIPPSLRKMEKGPEFWEKLSRVAPTIKERMM
KKGSMMLGYQPHRGKVNFFRQVIISPQVIREDMDFLLDEIDSLGKDL
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
atgggtcaaatccattttcagtttgagaccaagtgtggaacagatccattggagataccc
agggaacagtcttgccctggaaatggacttgcctctggcctgttgaaccaaatgaagttg
acagggtctttagagctgttaacacagctgcctgctatcctgtccctcctggttttgaaa
gcctccaggatgataatctacaggtgggtccaggaagtgattaatgcatcggtgaagaat
gaggtgttcccagcactatttaaggaagccttggtccacccactcctcaagaaatcatca
tcagacccatcctgtgtggacaatttatccaatttcccatctttcctttctagcaaagat
ggtggaaaaagtgggtgcgttgcagttcagatggtcctggatgaaaaggattatctggac
ccatttcagttgggtttcaggccacgttataggacagaaatggtattggttatgcttgtg
gatgatatctgtattatgtggctggtacttgtctgcttaaatgctaaagtcccagagcac
tttagcttcttcatagcagcctacttcaaaacattctgggtacttacagcatatcttgaa
atgaacaaccagctggaaaaatcacagaagaacaatgcaatcttagttgatggagttatt
ttaaatggcccagcagcagattcaaaatcaggcgagaaatttgtggaagaggtcagtaag
atcataatggaagaagtggtaaagaaagcatctgatgcaactgaaaaggtgtgtgaatgg
cagtctcctgagaaactgagaacacttcttgatttggaattgaaagacacaggagagagt
catcccaaactcttgcagttatgccaggatgttatacaattcagcgtcaaaacctatcac
ccaagattttttaatcagctctatgctggtattgattattactctttagcagcacgtttc
attatggaggcattaaacccaagtgtatatacctatgaaatttctccagtatttttacta
gtggaagaagcagtcctaaagaaaatgattgaatatataggatgggaaggaggagatggt
atatttaatccaggtggctctgtttccaatatgtatgcaatgaacttggcaagatacaaa
tattttcctgacataaaagaaaaaggcctttctgggatacctcagttggttctgtttaca
tcagaagagtgtcactattcagtgaagaaggcagcttcctttttgggaattggcacacaa
aatgtttactttgtcaaaagtgatgacagaggtaagatgattcctgaggagctggagaaa
caagtccagcgggcaaggaatgaggggtctgcaccattttttgtcagtgctacagctggt
accaccgttttgggagcatttgatcctctgaatgagatagctgatatatgtgaaaaatac
aatctttggctgcatgttgatgcatcatggggaggctcagctttgctgtcaaggaagcat
cgcaagcttcttcatggcatccacagagccacttctgttgcatggaatcctcataagatg
cttatggcaggaatccagtgttgtgcgcttctggtgaaagacaattctgacttgcttaag
agatgctactctgccaatgcctcatatctgttccagcaggacaaattttatgacatcagc
tatgacacaggtgataaatccatccagtgtagcagaagagcagatgcatttaaattctgg
atgacatggaaagctatggggacaactggccttgaggagagagtaaatagagcccttgct
ttagtcaggtacttagtggatgaaattaagaagagagaaggatttcaattgcttctggag
ccagaatatgcaaatatttgcttctggtatattccacctagcctaagaaagatggagaaa
ggaccagaattctgggaaaagctcagtcgtgttgcacccaccattaaagaaagaatgatg
aaaaagggtagcatgatgctgggttatcaacctcatcgtggaaaagttaatttcttccgc
caagtcatcattagtccccaggtgatccgtgaagacatggacttcctacttgatgagatt
gattcgcttgggaaagacttgtag

DBGET integrated database retrieval system