KEGG   Protobothrops mucrosquamatus (Taiwan habu): 107284378
Entry
107284378         CDS       T05763                                 

Gene name
TGFBR2
Definition
(RefSeq) TGF-beta receptor type-2
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
pmur  Protobothrops mucrosquamatus (Taiwan habu)
Pathway
pmur04010  MAPK signaling pathway
pmur04060  Cytokine-cytokine receptor interaction
pmur04068  FoxO signaling pathway
pmur04144  Endocytosis
pmur04218  Cellular senescence
pmur04350  TGF-beta signaling pathway
pmur04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:pmur00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107284378 (TGFBR2)
   04350 TGF-beta signaling pathway
    107284378 (TGFBR2)
   04068 FoxO signaling pathway
    107284378 (TGFBR2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107284378 (TGFBR2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107284378 (TGFBR2)
  09143 Cell growth and death
   04218 Cellular senescence
    107284378 (TGFBR2)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    107284378 (TGFBR2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pmur01001]
    107284378 (TGFBR2)
Enzymes [BR:pmur01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     107284378 (TGFBR2)
Protein kinases [BR:pmur01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   107284378 (TGFBR2)
SSDB
Motif
Pfam: ecTbetaR2 PK_Tyr_Ser-Thr Pkinase DAG1 Tetraspanin APH TMEM154 DUF2207 Orf78
Other DBs
NCBI-GeneID: 107284378
NCBI-ProteinID: XP_015667908
LinkDB
Position
Unknown
AA seq 560 aa
MSWIPKHILLWTLLHSTAHPLGRETAEYREHNFFSGGFKMGKLCKFCDVRLTTCTNEGHC
CSNCNITSICPKKNEICAAVWRKNNGNITLETICHDPTIELHGYKLDDFNSKKCMMKEKK
GAGGLLYMCSCKDDECNDEIIFSENTTSSTEVKYVIALVAVICLVPLLVIAIAVIIIFYF
YRVQRRRKLNKAWEKNVKSRKHKDCSDVCAIMLDDDRSDISSTCANNINHNTELLPIELD
TLVGKGRFAEVYKAKLKQNTSEQFETVAVKIFSYEEYASWKTEKDIFSDINLKHENILQF
LTAEERKTDLGKQYWLITAFHSRGNLQEYLIKHIISWEDLWKLGGSLARGIAHLHSDHTP
CGRPKTPIVHRDLKSSNILVKNDLACCLCDFGLSLKLDPTLSVDDLANSGQVGTARYMAP
EVLESRMNLDNVESFKQTDVYSMALVLWEMTSRCNGVGDVKDYEPPFGSKVREHPCVESM
KDNVLRDRGRPEIPSSWLNHQGIQKVCETIVECWDHDPEARLTAQCVAERFNDFDYQDGL
SGRSSSEEKIPEENSGNSTK
NT seq 1683 nt   +upstreamnt  +downstreamnt
atgagctggattcctaagcacattttgttatggactctcctgcacagtacggctcacccg
ctgggacgggaaacagctgaatatcgtgaacataacttctttagtggtggattcaaaatg
gggaaactatgcaaattttgtgatgttagattgacaacatgtaccaacgaaggtcattgt
tgcagtaactgcaacatcacttctatttgtccaaagaaaaatgaaatctgtgcagctgtt
tggagaaagaataatgggaacataaccttagaaacaatatgccatgatcctacaatagag
ctccacggttacaaattggatgatttcaattcgaagaaatgcatgatgaaagagaagaaa
ggagctggaggactgttatatatgtgttcctgcaaagatgatgaatgcaatgatgaaatt
attttttcagaaaataccacctcaagtacagaagtaaaatatgtgattgctttggtcgca
gttatatgccttgtcccgttgctggtgatcgccattgctgtgatcattatcttttacttc
taccgtgttcagaggaggaggaaactcaacaaggcatgggagaaaaatgtgaaatccaga
aagcacaaagactgtagcgatgtttgtgccattatgctggatgatgatcgctctgacatc
agttctacttgtgctaataatattaaccataacaccgaattgctgcctattgaattggac
actttggtaggcaaagggcgatttgcagaagtctataaggctaaactgaaacaaaacaca
tcagaacagtttgaaactgtggctgtcaagatcttctcctatgaagaatatgcctcctgg
aagactgagaaagatatcttttctgacataaatctaaaacatgagaacatcctacagttc
cttacagcagaggagcgcaagacagatctaggcaaacaatactggttgatcactgctttc
cattcaagaggcaacttgcaggaatatctcataaaacacatcattagttgggaggatctc
tggaaactgggtggctctttggctcgcgggattgcccatcttcatagtgatcacacacca
tgtggccggcccaagacgccaattgtccacagagacttgaagagttctaatatcctggta
aagaatgacctggcttgctgtctctgtgactttggattatccttaaagttggatcctact
ctctctgttgatgacctggctaatagtgggcaggttggtacagcaagatacatggctcct
gaagtcctggaatccagaatgaacttggataatgttgaatcctttaaacagactgatgtg
tattccatggctttggttctgtgggaaatgacatctcgctgcaatggtgttggagatgtg
aaagactacgagccaccatttggttcaaaagtacgagaacatccttgtgtagaaagcatg
aaggacaatgttttgagggacagaggacggcctgagattcctagttcatggctcaaccat
cagggtatccagaaggtgtgcgagactattgttgagtgttgggaccacgatcctgaggcc
cggctgacggcacagtgtgtagctgagaggttcaatgattttgattaccaagatggactc
tcgggaagaagcagctcagaagagaagatccctgaagaaaactctggcaacagcaccaag
taa

DBGET integrated database retrieval system