KEGG   Protobothrops mucrosquamatus (Taiwan habu): 107284548Help
Entry
107284548         CDS       T05763                                 

Gene name
GSTZ1
Definition
(RefSeq) maleylacetoacetate isomerase isoform X1
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
pmur  Protobothrops mucrosquamatus (Taiwan habu)
Pathway
pmur00350  Tyrosine metabolism
pmur01100  Metabolic pathways
Module
pmur_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:pmur00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    107284548 (GSTZ1)
Enzymes [BR:pmur01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     107284548 (GSTZ1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_3 GST_C GST_C_2 GST_C_5
Motif
Other DBs
NCBI-GeneID: 107284548
NCBI-ProteinID: XP_015668105
LinkDB All DBs
Position
Unknown
AA seq 217 aa AA seqDB search
MCAALAKPVLYTYFRSSCSWRVRIALALKGIAYEQASINLIKDGGQQMTSDFQAVNPMQQ
VPAIKIDGIILSQSLAIIEYLEDTRPLPRLLPQDPKKRAMVRMISNHVASGIQPLQNLAV
LQQMGEKKLDWAQRIISQGFKALEQILQETAGCYCVGDEVTMADLCLVPQVYNAERFKMD
LTPYPTISRINRALLELEAFQSSHPSQQPDTPPELRS
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgccgcgttagcaaagccagttctttacacttatttcagaagctcctgctcctgg
agagtgcgaatcgcattggctcttaagggaattgcctatgaacaagcatccataaatctt
ataaaggatggagggcagcagatgacttcagactttcaagcagtgaatccaatgcagcaa
gtccctgccatcaaaatcgatggcatcattctctcccaatctctagccatcatagagtat
ttggaggacacccggccactcccacggctccttcctcaggatccaaagaagagagctatg
gttcggatgatctcaaatcatgttgcttctggaattcaaccactgcagaatctggctgtc
ctgcagcagatgggagagaaaaagctagattgggcccaacgcatcatttctcaaggcttc
aaagctttggaacagatcctgcaagaaacagctggctgctactgtgttggggatgaggtg
accatggcagacctttgcttggtcccccaagtatacaatgctgagagatttaaaatggat
ctgactccataccccacaataagcagaatcaacagagctctcctagaattggaagcattt
caaagcagccatccttcccagcagccagatacacctccagaactaagatcctaa

DBGET integrated database retrieval system