KEGG   Protobothrops mucrosquamatus (Taiwan habu): 107284683Help
Entry
107284683         CDS       T05763                                 

Definition
(RefSeq) glutathione S-transferase omega-1-like
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
pmur  Protobothrops mucrosquamatus (Taiwan habu)
Pathway
pmur00480  Glutathione metabolism
pmur00980  Metabolism of xenobiotics by cytochrome P450
pmur00982  Drug metabolism - cytochrome P450
pmur00983  Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:pmur00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    107284683
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    107284683
   00982 Drug metabolism - cytochrome P450
    107284683
   00983 Drug metabolism - other enzymes
    107284683
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pmur02000]
    107284683
Enzymes [BR:pmur01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     107284683
Transporters [BR:pmur02000]
 Other Transporters
  Pores ion channels [TC:1]
   107284683
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_3 GST_C_2 GST_C Glutaredoxin GST_C_5
Motif
Other DBs
NCBI-GeneID: 107284683
NCBI-ProteinID: XP_015668268
LinkDB All DBs
Position
Unknown
AA seq 242 aa AA seqDB search
MSGEFARSLGKGASAPGPVPEGIVRLYSMRYCPFAQRTRLVLKAKGINHEIVNINLKNKP
EWFFEKSPFGLVPVLETSKGQLIYESPITCEYLDEAYPEKKLYPADPYEKAYQKMLLEYF
SKLPPIGYKYTLAIRNGEDASALKSEYQEKLLKLEEMLANHKTKFFGGDSVSMIDYLIWP
WFERMEASQLIECLNHTPELKCWVDMMKLDPAVKATITDPQIFKGYLELYFNNSPEACDY
GL
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgtctggggaattcgctagaagcttgggaaaaggagcctctgctccagggccagtgcct
gaaggaatcgtccgtctctacagtatgcgttactgccctttcgcacagagaacacgactc
gtcctgaaagccaaaggaatcaaccatgaaattgttaatatcaatttgaaaaacaaacca
gagtggttttttgagaagagcccatttggattggtacctgtgctagaaacaagcaagggt
cagctgatctatgaatctccaatcacttgtgaatatttggatgaagcttatccagaaaag
aaattgtaccctgcggacccttatgaaaaagcttatcagaaaatgctcctggaatacttc
tccaagctacctccaataggctacaagtatactctggctatcaggaatggtgaagatgca
tcagcactaaagagtgaataccaggagaagcttcttaagcttgaagagatgcttgcaaac
cacaaaactaagttctttggtggagattcagtatccatgattgattatctaatctggcca
tggtttgaacggatggaggcctcccagttaattgaatgtttgaaccatactccagaatta
aaatgctgggttgatatgatgaagctagatccagctgttaaggctacaataactgatcct
caaatcttcaagggttatcttgaactatatttcaataatagtcctgaggcctgtgattat
ggcctttga

DBGET integrated database retrieval system